Primary Antibodies

Rabbit polyclonal GLUR2 antibody (Ser880)

CDK9 antibody was raised in Rabbit using Human CDK9 as the immunogen

Rabbit polyclonal FAS antibody (Tyr291)

Mouse monoclonal GBA3 antibody

The JAK2 antibody is a glycoprotein that acts as a multidrug inhibitor. It specifically targets the p38 mitogen-activated protein, which plays a crucial role in various cellular processes. This antibody is widely used in Life Sciences research and has proven to be an effective tool for studying protein kinases and their functions.

Please enquire for more information about Affinity Purified anti-Digoxigenin Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal Mouse anti-FLAG-Tag (TM) Antibody recognizes N-terminal, C-terminal or internal DYKDDDDK-tagged fusion proteins. Validated for use in Western Blot and ELISA assays.

Please enquire for more information about Affinity Purified anti-COVID-19 Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

The Tuberin antibody is a highly specialized protein complex used in Life Sciences research. It is an essential tool for studying various biomolecules and their interactions. This antibody specifically targets tuberin, a protein involved in the regulation of cell growth and proliferation. By binding to tuberin, this antibody can help researchers understand the mechanisms behind diseases such as cancer and neurological disorders.

Carbonic Anhydrase Vb antibody (Mitochondrial) was raised using the N terminal of CA5B corresponding to a region with amino acids WRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPL

Please enquire for more information about Affinity Purified anti-C-Myc Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Affinity Purified anti-V5 Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

The purified Cat IgG h+l can be utilized for ELISA, Western Blot and as a Blocking Agent. Please inquire for bulk pricing.

Purified Mouse anti-SFTS Virus Antibody. Severe fever with thrombocytopenia syndrome.

Please enquire for more information about anti-Dengue Envelope Protein Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Purified Mouse anti-Cat IgE Antibody

Monoclonal Mouse anti-Human Cardiac Troponin I

Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.

Rabbit polyclonal APBB1IP antibody

STAT3 antibody was raised in mouse using recombinant Signal Transducer And Activator Of Transcription 3 (Acute-Phase Response Factor)

Rabbit polyclonal SORD antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. Specifically designed to combat tuberculosis infection, this compound exhibits bactericidal activity against mycobacterium strains. It achieves this by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Additionally, it has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. This compound undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Notably, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

PTBP1 antibody was raised using the middle region of PTBP1 corresponding to a region with amino acids KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI

The BMX antibody is a powerful tool for researchers in the field of molecular biology. It is an antibody that specifically targets and binds to the BMX protein, a member of the tyrosine kinase family. This antibody can be used in various applications, such as Western blotting, immunoprecipitation, and immunofluorescence.

Rabbit polyclonal Cyclin D3 antibody (Thr283)

Rabbit polyclonal APOL5 antibody

The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including