Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,566 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75323 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Alirocumab
CAS:<p>Monoclonal antibody to PCSK9 ; inhibitor of proprotein convertase PCSK9</p>Purity:Min. 95%Color and Shape:LiquidAffinity Purified anti-Human IgG Fc Antibody
<p>Purified Mouse anti-Human IgG (gamma chain specific) Monoclonal Antibody</p>Purity:Min. 95%LDHC antibody
<p>LDHC antibody was raised using the middle region of LDHC corresponding to a region with amino acids IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV</p>RARB antibody
<p>RARB antibody was raised using the C terminal of RARB corresponding to a region with amino acids SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS</p>PSCA antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, thereby inhibiting bacterial growth. Its effectiveness has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. The active form of this drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>PAK7 antibody
<p>The PAK7 antibody is a highly specialized product in the field of Life Sciences. It is an anti-MERTK antibody that specifically targets and binds to the activated form of the MERTK protein. This antibody is designed to facilitate antigen-antibody reactions, making it an essential tool for various research applications.</p>ETFB antibody
<p>ETFB antibody was raised using the C terminal of ETFB corresponding to a region with amino acids TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP</p>PAK4 antibody
<p>The PAK4 antibody is a protein that specifically targets and neutralizes the activity of PAK4. It belongs to the class of polyclonal antibodies, which are widely used in life sciences research. PAK4 is an important enzyme involved in various cellular processes, including cell migration, proliferation, and survival. The PAK4 antibody can be used in experiments to study the role of PAK4 in these processes. It can also be used as a diagnostic tool to detect the presence of autoantibodies against PAK4 in certain diseases. Additionally, monoclonal antibodies targeting PAK4 have been developed and can be used as therapeutic agents to inhibit its activity. The PAK4 antibody is available as both polyclonal and monoclonal forms, and it has been extensively validated for its specificity and efficacy.</p>ITGA6 antibody
<p>The ITGA6 antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes, including adipose tissue development, dopamine signaling, and immune response. This monoclonal antibody specifically targets the integrin alpha 6 (ITGA6), which is a protein complex involved in cell adhesion and migration.</p>anti-Human Troponin I Monoclonal Antibody
<p>Monoclonal Mouse anti-Human Cardiac Troponin I</p>Purity:Min. 95%N cadherin antibody
<p>The N cadherin antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes such as cell adhesion, differentiation, and migration. This antibody specifically targets N cadherin, a protein that is involved in cell-cell adhesion and signaling.</p>TOE1 antibody
<p>TOE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERY</p>
