Primary Antibodies

<p>Please enquire for more information about Cytomegalovirus (CMV) EIA Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>LIN7C antibody was raised in Rabbit using Human LIN7C as the immunogen</p>

<p>Rabbit polyclonal PNCK antibody</p>

<p>Rabbit polyclonal TROAP antibody</p>

<p>MPS1 antibody was raised in Mouse using a purified recombinant fragment of MPS1 expressed in E. coli as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, thereby inhibiting bacterial growth. Its effectiveness has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. The active form of this drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>RARB antibody was raised using the C terminal of RARB corresponding to a region with amino acids SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS</p>

<p>TOE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERY</p>

<p>The UROD antibody is a highly specialized monoclonal antibody that has neutralizing properties against annexin A2. This antibody is colloidal in nature and is used in Life Sciences research to study the role of annexin A2 in various cellular processes. It has been shown to inhibit the activity of glucagon, a hormone involved in glucose metabolism. The UROD antibody specifically targets the amino-terminal region of annexin A2, which is activated under certain conditions. This monoclonal antibody can be used in experiments to investigate the function of annexin A2 and its potential as a therapeutic target for various diseases, including cardiomyocyte dysfunction and natriuretic factor regulation. Additionally, polyclonal antibodies targeting annexin A2 are also available for research purposes.</p>

<p>Rabbit polyclonal PTK6 antibody</p>

<p>Rabbit polyclonal TEX11 antibody</p>

<p>The CYP2J2 antibody is a powerful tool used in the field of life sciences. It is a monoclonal antibody that specifically targets the CYP2J2 enzyme, which plays a crucial role in the metabolism of arachidonic acid. This antibody has high bioavailability and can effectively neutralize the activity of CYP2J2.</p>

<p>NADK antibody was raised in Rabbit using Human NADK as the immunogen</p>

<p>The PAK4 antibody is a protein that specifically targets and neutralizes the activity of PAK4. It belongs to the class of polyclonal antibodies, which are widely used in life sciences research. PAK4 is an important enzyme involved in various cellular processes, including cell migration, proliferation, and survival. The PAK4 antibody can be used in experiments to study the role of PAK4 in these processes. It can also be used as a diagnostic tool to detect the presence of autoantibodies against PAK4 in certain diseases. Additionally, monoclonal antibodies targeting PAK4 have been developed and can be used as therapeutic agents to inhibit its activity. The PAK4 antibody is available as both polyclonal and monoclonal forms, and it has been extensively validated for its specificity and efficacy.</p>

<p>Human Haptoglobin Reference Serum</p>

<p>HUS1B antibody was raised using a synthetic peptide corresponding to a region with amino acids ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF</p>

<p>Carbonic Anhydrase I antibody was raised using the N terminal of CA1 corresponding to a region with amino acids ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS</p>

<p>Rabbit polyclonal SGK3 antibody</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (biotin); Neat Serum with no preservatives.</p>

<p>Rabbit polyclonal PFDN5 antibody</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>The SSRP1 antibody is a highly potent growth factor that acts as a phosphatase in various bioassays. It is specifically activated by human serum and has neutralizing properties. This antibody, widely used in Life Sciences research, targets tyrosine kinase receptors and 3-kinases to regulate cellular processes. It can be utilized in electrode-based experiments and is commonly employed in the field of Antibodies research. Additionally, the SSRP1 antibody has been found to exhibit genotoxic effects and shows potential as an anti-beta amyloid agent for combating amyloid protein-related disorders.</p>