Primary Antibodies

Drebrin antibody was raised in guinea pig using a synthetic human peptide corresponding to residues 324-343 of drebrin coupled to KLH as the immunogen.

The PKC alpha antibody is a highly specialized antibody that targets the protein kinase C alpha (PKCα) enzyme. It is commonly used in life sciences research to study various cellular processes and signaling pathways. This monoclonal antibody specifically binds to the activated form of PKCα, allowing researchers to detect and analyze its activity in different cell types.

The Connexin 43 antibody is a highly specialized antibody used in Life Sciences research. It targets the protein Connexin 43, which plays a crucial role in cell communication and signaling. This antibody is available in both polyclonal and monoclonal forms.

The GLUT4 antibody is a glycoprotein that plays a crucial role in glucose metabolism. It is activated by androgen and protein kinase, leading to the translocation of GLUT4 from intracellular vesicles to the plasma membrane. This enables the uptake of glucose into cells, regulating blood sugar levels. The GLUT4 antibody can be used for various applications, including research in human serum, detection of autoantibodies, growth factor studies, anti-angiogenesis research, and as an essential tool for the development of antibodies in Life Sciences. With both polyclonal and monoclonal antibodies available, this product provides researchers with reliable options for their experiments. Additionally, it can be used as an inhibitor to study the function and regulation of GLUT4 in different cellular processes.

KLHL18 antibody was raised in Rabbit using Human KLHL18 as the immunogen

FGF19 antibody is a highly specialized drug antibody that targets fibroblast growth factor 19 (FGF19). FGF19 is a growth factor that plays a crucial role in regulating the metabolism of fatty acids. This antibody has been developed for use in antiestrogen therapy, as it can effectively block the activity of FGF19 and inhibit its effects on adipose tissue.

Affinity purified Rabbit polyclonal PPP2R5B antibody

Affinity purified Rabbit polyclonal COUP TF1 antibody

The RALA antibody is a glycopeptide that acts as an anticoagulant by neutralizing the viscosity of fibrinogen. It belongs to the class of peptide agents known as antibodies, which are widely used in Life Sciences research. This antibody specifically binds to glycan-binding proteins and has been shown to have toxic effects on various cell types. Additionally, it has been found to inhibit the activity of colony-stimulating factors such as interleukin-6, making it a valuable tool for studying immune responses and cell signaling pathways. The RALA antibody is a polyclonal antibody, meaning it recognizes multiple epitopes on its target protein, increasing its versatility in experimental applications.

PHF19 antibody was raised in rabbit using the C terminal of PHF19 as the immunogen

Rabbit polyclonal CHMP2A antibody (HRP)

Rabbit polyclonal THAP2 antibody

IL27 antibody was raised in rabbit using the C terminal of IL27 as the immunogen

NR5A1 antibody was raised using the middle region of NR5A1 corresponding to a region with amino acids SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA

The FANCA antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the FANCA protein, which plays a crucial role in DNA repair and maintenance. By binding to FANCA, this antibody inhibits its proteolytic activity, preventing it from degrading important cellular components.

The A2M antibody is a powerful inhibitor of vascular endothelial growth factor (VEGF), which plays a crucial role in angiogenesis. It is also effective against other growth factors such as alpha-fetoprotein and erythropoietin. In addition, this antibody has been shown to inhibit the growth of Helicobacter, a bacteria that causes gastric ulcers. The A2M antibody works by binding to calmodulin, a protein involved in cell signaling, and preventing its activation. This inhibition leads to antiangiogenic effects and reduces the acidic environment necessary for tumor growth. Furthermore, the A2M antibody has anticoagulant properties that can be beneficial for patients with conditions such as heparin-induced thrombocytopenia. With its wide range of applications in life sciences, this polyclonal antibody is an essential tool for researchers and scientists working in various fields.

Affinity purified Rabbit polyclonal Copine 3 antibody

Affinity purified Rabbit polyclonal SERPINI2 antibody

The Beta tubulin antibody is a highly specific monoclonal antibody used in the field of Life Sciences. It is widely recognized for its ability to target and bind to beta tubulin, a protein involved in cell division and intracellular transport. This antibody plays a crucial role in various research applications, including the study of amyloid plaque formation, growth factor signaling pathways, antiangiogenic therapies, and the development of inhibitors such as taxol.

HEXA antibody is a highly specific and potent polyclonal antibody used in life sciences research. It is also available as a monoclonal antibody. This antibody specifically targets the natriuretic hormone peptide, TGF-beta, and has neutralizing properties. It can be used to study the role of these hormones in various biological processes. Additionally, HEXA antibody has cytotoxic effects on cells expressing certain growth factors, making it a valuable tool for studying cell signaling pathways. Moreover, this antibody can be used in studies related to lipid metabolism as it targets enzymes such as triglyceride lipase and lipoprotein lipase. Its wide range of applications makes HEXA antibody an essential component of any research project in the fields of life sciences and medicine.

Rabbit polyclonal CYB5R3 antibody (HRP)

The IgG1 antibody is a highly versatile and potent medicament that belongs to the class of antibodies. It is activated upon binding to specific antigens, leading to cytotoxic effects on target cells. IgG1 antibodies play a crucial role in the immune response by neutralizing pathogens and promoting phagocytosis. These antibodies are widely used in life sciences research, diagnostics, and therapeutic applications.

Affinity purified Rabbit polyclonal CYP11B1 antibody

Affinity purified Rabbit polyclonal B-cell linker protein antibody

IVD antibody is a reactive growth factor that belongs to the class of monoclonal antibodies. It specifically targets cysteine-rich proteins and can be used to detect autoantibodies in various assays. The IVD antibody has high affinity for tumor necrosis factor-alpha (TNF-α), a glycoprotein involved in inflammation and immune response. This antibody can be used in immunohistochemistry, Western blotting, and other techniques such as electrophoresis to study protein expression and localization. Additionally, the IVD antibody has been shown to modulate transmembrane conductance and act as an angiogenic inducer by targeting chemokines and activated cells. Overall, this versatile monoclonal antibody offers a valuable tool for researchers studying various biological processes and diseases.

The NKG2D antibody is a highly specialized antibody that targets the vasoactive intestinal peptide. It belongs to the class of polyclonal antibodies and exhibits cytotoxic effects. This monoclonal antibody is designed to specifically bind to autoantibodies, preventing their harmful effects on the body. With its unique structure and composition of lysine and acid residues, this antibody has the ability to induce lysis of targeted cells. Its multidrug properties make it highly effective in combating various diseases and conditions. The NKG2D antibody is activated upon binding to necrosis factor-related apoptosis-inducing markers, leading to targeted cell death. Its nuclear-specific targeting makes it a valuable tool in research and diagnostics. With its multispecific nature, this monoclonal antibody offers a versatile solution for a wide range of applications.

Sheep polyclonal Ritodrine antibody

The Beta Lactoglobulin antibody is a polyclonal antibody that is immobilized and used as an inhibitor of CD20 antibodies. It specifically targets the beta lactoglobulin antigen, which is a glycoprotein found in milk. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as a potential therapeutic agent. It can be used in various applications, including research on proproteins, monoclonal antibodies, antibody-drug conjugates, cytotoxicity assays, chemokine studies, and the production of recombinant proteins. With its high specificity and affinity for the target antigen, the Beta Lactoglobulin antibody offers great potential for advancing scientific discoveries in various fields.

The LHR antibody is a high-quality polyclonal antibody that specifically targets the luteinizing hormone receptor (LHR). It is widely used in various research fields, particularly in the life sciences. This antibody is highly specific and exhibits strong binding affinity to LHR, making it an excellent tool for studying the role of LHR in different biological processes.

Rabbit polyclonal PITPNM1 antibody

Rabbit polyclonal LPHN2 antibody

Mouse monoclonal BDH2 antibody

NHP2L1 antibody was raised in Rabbit using Human NHP2L1 as the immunogen

Rabbit polyclonal APT2 antibody (FITC)

CAD antibody was raised using the middle region of CAD corresponding to a region with amino acids SVSNNNRTSPSKPPYFDWMKKPAYPAQPQPGKTRTKDKYRVVYTDFQRLE

The PERK antibody is a polyclonal antibody used in life sciences research. It is designed to specifically target and neutralize the activated form of PERK (protein kinase RNA-like endoplasmic reticulum kinase). This monoclonal antibody can be used for various applications, including Western blotting, immunoprecipitation, and immunofluorescence.

Calpain 10 antibody was raised using the N terminal of CAPN10 corresponding to a region with amino acids MRAGRGATPARELFRDAAFPAADSSLFCDLSTPLAQFREDITWRRPQEIC

Lamin B1 antibody was raised using the middle region of LMNB1 corresponding to a region with amino acids EEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM

RORA antibody was raised using the middle region of RORA corresponding to a region with amino acids  GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP

Donkey anti Goat IgG (H + L) secondary antibody

Rabbit polyclonal SERPINA10 antibody

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.