Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
SGLT1 antibody
SGLT1 antibody was raised in rabbit using a 19 amino acid peptide sequence of mouse/rabbit SGLT-1 as the immunogen.Purity:Min. 95%AKR1C1 antibody
The AKR1C1 antibody is a potent family kinase inhibitor that targets specific growth factors, such as glucagon and epidermal growth factor. It is a polyclonal antibody that has been developed for neutralizing the effects of these growth factors in various biological systems. The antibody is formulated with excipients to ensure stability and efficacy. It can be used in various life science applications, including research and diagnostics. Additionally, the AKR1C1 antibody can also target other proteins, such as β-catenin, chemokines, alpha-fetoprotein, and globulins. Its specificity and effectiveness make it an essential tool for studying protein-protein interactions and cellular signaling pathways.
Purity:Min. 95%WTAP antibody
The WTAP antibody is a highly specialized monoclonal antibody that has a wide range of applications in the field of Life Sciences. It acts as an inhibitory factor, blocking specific protein interactions and pathways. This antibody is produced using state-of-the-art technology and is free from any harmful excipients.
P38 MAPK antibody
The P38 MAPK antibody is a highly specialized tool used in Life Sciences research. It is an electrode-based antibody that specifically targets and binds to the p38 mitogen-activated protein kinase (MAPK) antigen. This antibody is widely used in various research assays to study the role of p38 MAPK in cellular processes such as glucose-6-phosphate metabolism, inflammation, and cell signaling.
Purity:Min. 95%Goat anti Human kappa chain (HRP)
This antibody reacts with kappa light chains on human immunoglobulins.Purity:Min. 95%RAB40A antibody
RAB40A antibody was raised using the middle region of RAB40A corresponding to a region with amino acids RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR
Purity:Min. 95%SHARPIN antibody
SHARPIN antibody was raised in rabbit using the C terminal of SHARPIN as the immunogen
Purity:Min. 95%RFC5 antibody
RFC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINE
Purity:Min. 95%Ribophorin II antibody
Ribophorin II antibody was raised using the middle region of RPN2 corresponding to a region with amino acids IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSP
Purity:Min. 95%CHST1 antibody
CHST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL
GSG1 antibody
GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE
Purity:Min. 95%ILK antibody
The ILK antibody is a powerful tool used in scientific research and diagnostics. This monoclonal antibody specifically targets ILK (Integrin-Linked Kinase), a key protein involved in various cellular processes. It plays a crucial role in cell adhesion, migration, proliferation, and survival.
Goat anti Human IgG (HRP)
Goat anti-human IgG (HRP) was raised in goat using human IgG gamma chain as the immunogen.Purity:Min. 95%SYCP1 antibody
SYCP1 antibody was raised using the N terminal of SYCP1 corresponding to a region with amino acids NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV
Purity:Min. 95%Calmodulin antibody
Calmodulin antibody was raised in mouse using calmodulin purified from Dictyostelium discoideum as the immunogen.
MVP antibody
MVP antibody was raised using the N terminal of MVP corresponding to a region with amino acids MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM
CD100 antibody
The CD100 antibody is a monoclonal antibody that targets the erythropoietin receptor. It has been widely used in the field of Life Sciences for various applications. This antibody specifically binds to the erythropoietin receptor, which plays a crucial role in red blood cell production and differentiation. By targeting this receptor, the CD100 antibody can modulate erythropoiesis and potentially have therapeutic effects on conditions related to red blood cell disorders.
SITPEC antibody
SITPEC antibody was raised in rabbit using the middle region of SITPEC as the immunogen
Purity:Min. 95%Fibronectin antibody (biotin)
Fibronectin antibody was raised in rabbit using fibronectin purified from human plasma as the immunogen.
LTBR antibody
The LTBR antibody is a highly effective tool in the field of Life Sciences. It specifically targets and inhibits the activity of glycoproteins involved in various cellular processes. This polyclonal antibody has been extensively studied and shown to have potent cytotoxic effects on activated cells. Additionally, it has been found to interfere with the p38 mitogen-activated protein kinase (MAPK) pathway, a key signaling pathway involved in cell proliferation and survival.
ZHX2 antibody
The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.
Purity:Min. 95%SOX2 antibody
The SOX2 antibody is a highly specific and reliable tool used in immunohistochemistry and other life science research applications. This monoclonal antibody binds to the SOX2 antigen, which is a nuclear DNA-binding protein involved in the regulation of embryonic development and cell differentiation. The SOX2 antibody has been extensively validated for its performance in various experimental techniques, including electrochemical impedance spectroscopy.
FZD8 antibody
The FZD8 antibody is a diagnostic reagent that plays a crucial role in the field of Life Sciences. It is an antigen-specific antibody that specifically targets and binds to the FZD8 protein. This antibody is widely used in various research applications, including immunohistochemistry, western blotting, and flow cytometry.
PRKAR2A antibody
PRKAR2A antibody was raised in rabbit using the middle region of PRKAR2A as the immunogen
