Primary Antibodies

OR6C70 antibody was raised using the C terminal of OR6C70 corresponding to a region with amino acids GSCMFIYIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFK

ABCB1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

CHIT1 antibody was raised in Mouse using a purified recombinant fragment of CHIT1(aa22-137) expressed in E. coli as the immunogen.

The AMPD1 antibody is a highly specialized product in the field of Life Sciences. It is an activated monoclonal antibody that specifically targets and detects AMPD1, an enzyme involved in fatty acid metabolism. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications.

Rabbit polyclonal IKBE antibody (Ser22)

COL6A2 antibody was raised in Rabbit using Human COL6A2 as the immunogen

Human Growth Hormone antibody was raised in Rat using recombinant human growth hormone as the immunogen.

Rabbit polyclonal TRIP4 antibody

EWSR1 antibody was raised using the N terminal of EWSR1 corresponding to a region with amino acids PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ

POLK antibody was raised using a synthetic peptide corresponding to a region with amino acids ATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQ

The CD38 antibody is a highly specialized monoclonal antibody that binds to CD38, a protein found on the surface of certain cells. This antibody has cytotoxic properties and can be used in various applications, including research and diagnostics. It specifically targets CD38-expressing cells and can be used to study their function or as a therapeutic agent.

Arginase 2 antibody was raised using the C terminal of ARG2 corresponding to a region with amino acids SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT

MYST1 antibody was raised in Mouse using a purified recombinant fragment of human MYST1 expressed in E. coli as the immunogen.

NUSAP1 antibody was raised using the C terminal of NUSAP1 corresponding to a region with amino acids LKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQ

Neurochondrin antibody was raised using the N terminal of NCDN corresponding to a region with amino acids MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS

Mouse monoclonal SHPRH antibody

Rabbit polyclonal TRIM54 antibody

MAFF antibody was raised in Rabbit using Human MAFF as the immunogen

Mouse monoclonal anti human CREG1 antibody

Rabbit polyclonal RBBP6 antibody

MTRR antibody was raised using the N terminal of MTRR corresponding to a region with amino acids YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL

EIF3D antibody was raised in Rabbit using Human EIF3D as the immunogen

ZKSCAN1 antibody was raised in rabbit using the N terminal of ZKSCAN1 as the immunogen

Purified Polyclonal NCKX1 antibody

CSNK1G1 antibody was raised in rabbit using the middle region of CSNK1G1 as the immunogen

Gabrp antibody was raised in rabbit using the N terminal of Gabrp as the immunogen

FABP5 antibody was raised in Rabbit using Human FABP5 as the immunogen

The GPR158 antibody is a monoclonal antibody that specifically targets GPR158, a cationic receptor involved in various biological processes. This antibody has been extensively tested and validated for its specificity and effectiveness in scientific research. It can be used in a wide range of applications, including immunohistochemistry, Western blotting, and ELISA.

The TALDO1 antibody is a highly specialized protein that belongs to the group of polyclonal antibodies. It is used in life sciences research to detect and study transaldolase, an important enzyme involved in nucleic acid metabolism. This antibody specifically binds to TALDO1, making it a valuable tool for identifying and quantifying this biomarker in various biological samples. By targeting specific polypeptides, the TALDO1 antibody enables researchers to gain insights into the role of transaldolase in cellular processes and disease development. Its high specificity and sensitivity make it an essential component in many scientific experiments and studies.

INTS5 antibody was raised in Rabbit using Human INTS5 as the immunogen

The CIITA antibody is a powerful tool in the field of immunology. This antibody specifically targets and binds to the CIITA antigen, which plays a crucial role in immune system regulation. By binding to CIITA, this antibody can modulate immune responses and has potential applications in various areas of research and medicine.

Lamin B1 antibody was raised using the middle region of LMNB1 corresponding to a region with amino acids EEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM

Goat anti-mouse IgM (biotin) was raised in goat using murine IgM heavy chain as the immunogen.

The SH2 antibody is a polyclonal antibody that has cytotoxic properties. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets and inhibits the activity of family kinases, making it an effective inhibitor for various cellular processes. Additionally, the SH2 antibody has been shown to have neutralizing effects on proteins such as VEGF (vascular endothelial growth factor) and circumsporozoite protein. It can also be utilized in studies involving mesenchymal stem cells and has shown promising results in inhibiting their growth. The SH2 antibody is a valuable tool for researchers looking to study specific cellular pathways and investigate potential therapeutic targets.

TSH beta antibody was raised against Human TSH (intact).

The CDC42 antibody is a highly specific and potent polyclonal antibody that targets the protein CDC42. It can also be used as a monoclonal antibody. CDC42 is a small GTPase protein that plays a crucial role in various cellular processes, including cell growth, migration, and differentiation. This antibody has been extensively tested and validated for its ability to neutralize the activity of CDC42, making it an invaluable tool for researchers in the field of life sciences.

The Collagen I antibody is a highly specialized antibody that targets the amino-terminal region of collagen, a crucial protein in the extracellular matrix. This antibody has been extensively studied and proven to be effective in various research applications in Life Sciences.

Ribophorin II antibody was raised using the middle region of RPN2 corresponding to a region with amino acids IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSP

Rabbit polyclonal ZFP36L2 antibody

CIDEA antibody was raised in Rabbit using Human CIDEA as the immunogen