Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
UBE2L3 antibody
UBE2L3 antibody was raised using the C terminal of UBE2L3 corresponding to a region with amino acids TDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEK
PYGO1 antibody
PYGO1 antibody was raised in rabbit using the middle region of PYGO1 as the immunogen
Purity:Min. 95%FN3KRP antibody
FN3KRP antibody was raised using the N terminal of FN3KRP corresponding to a region with amino acids MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFA
CD117 antibody (Spectral Red)
CD117 antibody (biotin) was raised in rat using murine CD117/c-Kit as the immunogen.
Purity:Min. 95%Tropomyosin 2 antibody
Tropomyosin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL
Goat anti Mouse IgG (H + L)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.
Purity:Min. 95%Haptoglobin antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This active compound has been extensively studied using the patch-clamp technique on human erythrocytes, demonstrating its high frequency of human activity. Metabolized through various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation, this drug specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.
ANGPTL3 antibody
ANGPTL3 antibody was raised in rabbit using the N terminal of ANGPTL3 as the immunogen
Purity:Min. 95%NR0B1 antibody
NR0B1 antibody was raised using the N terminal of NR0B1 corresponding to a region with amino acids TSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRATALLYRCC
TSHR antibody
TSHR antibody is a monoclonal antibody that acts as an inhibitor of the epidermal growth factor family kinase. It specifically targets and binds to the thyroid-stimulating hormone receptor (TSHR) in the nucleus, preventing its activation by autoantibodies. This antibody has been shown to exhibit cytotoxic effects on cells expressing TSHR, inhibiting their growth and proliferation. Additionally, it has been found to modulate the activity of transforming growth factor-beta 1 (TGF-β1), a potent growth factor involved in various cellular processes. TSHR antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific experimental needs. Its use has also been associated with reduced superoxide production and protection against thrombocytopenia. With its ability to target TSHR and influence key signaling pathways, this antibody holds great potential for research in the fields of thyroid biology, autoimmune diseases, and cancer therapy.
beta Actin antibody
The beta Actin antibody is a powerful tool used in the field of Life Sciences for various applications. This antibody specifically targets the beta-actin protein, which plays a crucial role in cellular processes such as cell motility and structure. It is widely used in research to study the expression and localization of beta-actin in different cell types and tissues.
C Peptide antibody
C Peptide antibody was raised in mouse using human C-peptide-BSA as the immunogen.Purity:>95% Pure By Sds-PageFibrinopeptide A antibody
Fibrinopeptide A antibody was raised in mouse using Fibrinopeptide A conjugated with carrier protein as the immunogen.
HTR2B antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its potent bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication of bacteria. Extensive research has demonstrated its high efficacy through various techniques such as patch-clamp technique on human erythrocytes. The drug undergoes several metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, hindering cell growth in culture.
CTNNB1 antibody
CTNNB1 antibody was raised in rabbit using the C terminal of CTNNB1 as the immunogen
Purity:Min. 95%CHAT antibody
The CHAT antibody is a highly specialized monoclonal antibody that targets the cholinergic growth factor, choline acetyltransferase (CHAT). It plays a crucial role in the synthesis of acetylcholine, a neurotransmitter involved in various physiological processes. This antibody has been extensively studied for its ability to neutralize virus surface antigens and exhibit cytotoxic effects on cells expressing CHAT.
ZNF440 antibody
ZNF440 antibody was raised in rabbit using the N terminal of ZNF440 as the immunogenPurity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
