Primary Antibodies

<p>IL10 antibody is an antibody that specifically targets interleukin-10 (IL-10), a chemokine involved in immune response regulation. This antibody can be used in various research applications, such as studying the role of IL-10 in inflammation, autoimmune diseases, and cancer. It can also be used as a diagnostic tool to detect IL-10 levels in patient samples. IL10 antibody is available in both polyclonal and monoclonal forms, offering researchers different options based on their specific needs. The polyclonal antibodies are generated by immunizing animals with IL-10 protein, while the monoclonal antibodies are produced from a single clone of cells that recognize a specific epitope on IL-10. Both types of antibodies have been extensively validated for their specificity and sensitivity. Whether you're conducting experiments in Life Sciences or working on developing new therapeutics, IL10 antibody can provide valuable insights into the functions of IL-10 and its potential as a therapeutic target.</p>

<p>Rabbit polyclonal Aldolase antibody (FITC)</p>

<p>The FGFR2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the fibroblast growth factor receptor 2 (FGFR2), a protein that plays a crucial role in cell growth and development. This antibody can be used in various assays to detect and measure the levels of FGFR2 in different biological samples.</p>

<p>Rabbit polyclonal p15 INK antibody</p>

<p>RGR antibody is a highly specialized antibody that targets the insulin-like growth factor-I (IGF-I). It belongs to the class of antibodies known as adeno-associated antibodies, which have been shown to have an inhibitory effect on adeno-associated viral (AAV) vectors. The RGR antibody specifically neutralizes the activity of CXCL13, a chemokine involved in various biological processes. In the field of Life Sciences, this antibody has demonstrated an anti-angiogenic effect by inhibiting blood vessel formation. Additionally, it has shown promise as a potential therapeutic agent for conditions such as fibrosis and cancer due to its anti-fibrotic properties and its ability to modulate the behavior of mesenchymal stem cells. The RGR antibody is widely used in research and is available as a polyclonal antibody, making it a valuable tool for scientists studying IGF-I-related pathways.</p>

<p>The hCG alpha antibody is a phosphatase that belongs to the group of monoclonal antibodies. It specifically targets and binds to the hCG (human chorionic gonadotropin) alpha subunit. This antibody has been shown to have high affinity and specificity for the hCG alpha subunit, making it an ideal tool for various applications in life sciences research. The hCG alpha antibody can be used in assays to detect and quantify hCG levels, such as pregnancy tests. It can also be used in immunohistochemistry and immunofluorescence experiments to study the expression and localization of hCG alpha subunit in tissues and cells. The use of this monoclonal antibody, along with other complementary reagents like alkaline phosphatases or insulin antibodies, allows for accurate and reliable detection of hCG alpha subunit in different experimental setups. With its unique properties and versatility, the hCG alpha antibody is a valuable tool for researchers working in the field of reproductive biology</p>

<p>Purified Rabbit polyclonal CCDC99 antibody</p>

<p>Purified Rabbit polyclonal IL13R antibody (Tyr405)</p>

<p>Rabbit Polyclonal IKK beta antibody (Tyr199)</p>

<p>The CD32 antibody is a highly versatile test compound that has a wide range of applications in various fields. It is a monoclonal antibody that specifically targets the CD32 receptor, which plays a crucial role in immune response regulation. This antibody can be used for research purposes, diagnostic tests, and therapeutic interventions.</p>

<p>LARP7 antibody was raised in Rabbit using Human LARP7 as the immunogen</p>

<p>Purified Rabbit polyclonal SLC9A3R2 antibody</p>

<p>EXOSC2 antibody was raised in Rabbit using Human EXOSC2 as the immunogen</p>

<p>ABCB6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VTEWRTKFRRAMNTQENATRARAVDSLLNFETVKYYNAESYEVERYREAI</p>

<p>FNBP1L antibody was raised in Rabbit using Human FNBP1L as the immunogen</p>

<p>The TAP antibody is a polyclonal antibody that is used in the field of life sciences. It is specifically designed to target and neutralize the growth factor interleukin-6 (IL-6). This antibody is highly effective in blocking the activity of IL-6, which plays a crucial role in various physiological processes such as inflammation and immune response. The TAP antibody has been extensively tested and proven to have high affinity and specificity for IL-6, making it an ideal tool for researchers studying the role of IL-6 in different biological systems. In addition, this antibody has low viscosity, allowing for easy handling and efficient use in various experimental techniques such as immunohistochemistry and Western blotting. Whether you are conducting basic research or developing therapeutics targeting IL-6, the TAP antibody is an essential tool that will provide reliable and reproducible results.</p>

<p>Lamin A/C Monoclonal Antibody</p>

<p>Rabbit polyclonal RGAP1 antibody</p>

<p>Rabbit polyclonal UBL4B antibody</p>

<p>Affinity purified Rabbit polyclonal C9orf98 antibody</p>

<p>Rat monoclonal CD104 antibody</p>

<p>Albumin antibody was raised in Mouse using Human albumin as the immunogen.</p>

<p>Rabbit polyclonal IFNG antibody (biotin)</p>

<p>The IBA1 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the ionized calcium-binding adapter molecule 1 (IBA1) protein, which is primarily expressed in mouse peritoneal macrophages. This antibody is commonly used for immunohistochemistry and immunofluorescence experiments to visualize and study the activation and behavior of macrophages in various tissues.</p>

<p>Calnexin antibody was raised in Mouse using synthetic peptide corresponding to aa (CEAAEERPWLWVVYILTVAL) of human Calnexin, conjugated to KLH as the immunogen.</p>

<p>BIN3 antibody was raised in Rabbit using Human BIN3 as the immunogen</p>

<p>6X His tag Monoclonal Antibody (HRP)</p>

<p>The GIRK1 antibody is a polyclonal antibody used in life sciences research for the detection and analysis of insulin. It specifically targets insulin, a hormone involved in regulating blood sugar levels. The GIRK1 antibody binds to insulin and can be used in various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assays (ELISAs). This antibody has been shown to have high specificity and sensitivity for insulin detection. It is particularly useful in studying conditions such as hyperinsulinaemic hypoglycaemia, where there is an excess production of insulin leading to low blood sugar levels. The GIRK1 antibody can also be used to investigate the role of insulin in growth factor signaling pathways and its interactions with other proteins such as phosphatases and kinases. With its ability to accurately detect and analyze insulin, the GIRK1 antibody is a valuable tool for researchers in the field of molecular biology and endocrinology.</p>

<p>PFKM antibody was raised in rabbit using the C terminal of PFKM as the immunogen</p>

<p>SMC1 antibody was raised in Mouse using a purified recombinant fragment of human SMC1 expressed in E. coli as the immunogen.</p>

<p>The VAV2 antibody is a highly specialized monoclonal antibody that targets the amino group of epidermal growth factor (EGF) and plays a crucial role in pluripotent stem cell research. This antibody is widely used in Life Sciences for its ability to specifically bind to VAV2, a protein involved in cellular signaling pathways. The VAV2 antibody can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry. It exhibits high affinity and specificity for its target, making it an ideal tool for studying the function and regulation of VAV2 in different biological systems. Additionally, this antibody has shown low background staining and excellent endocytic uptake properties, allowing for precise localization studies. Researchers also use polyclonal antibodies against collagen to validate their findings when using the VAV2 antibody. With its unique properties and wide range of applications, the VAV2 antibody is an indispensable tool for scientists working in the field of molecular biology and cellular signaling</p>

<p>Affinity purified Rabbit polyclonal IBSP antibody</p>

<p>The Bcl-2 antibody is a powerful tool in the field of immunology. It belongs to the class of polyclonal antibodies and monoclonal antibodies, which are widely used for their neutralizing and cytotoxic effects. This antibody specifically targets Bcl-2, a protein that plays a critical role in regulating cell death (apoptosis). By binding to Bcl-2, this antibody can interfere with its function and induce cell death in cancer cells.</p>

<p>CHAT antibody was raised in Rabbit using Human CHAT as the immunogen</p>

<p>The COMT antibody is a monoclonal antibody that is widely used in Life Sciences research. It has been specifically designed to target and neutralize the activity of catechol-O-methyltransferase (COMT), an enzyme involved in the metabolism of neurotransmitters and steroid hormones. This antibody can be used to study the role of COMT in various biological processes, including neurotransmission, oxidative stress, and hormone regulation. The COMT antibody is available as both a monoclonal and polyclonal antibody, allowing researchers to choose the format that best suits their experimental needs. It is produced using state-of-the-art techniques and undergoes rigorous quality control to ensure its specificity and effectiveness. The COMT antibody is supplied in a convenient format with all necessary excipients for immediate use in experiments. Whether you are studying the function of COMT or investigating its potential as a therapeutic target, the COMT antibody is an essential tool for your research.</p>

<p>Purified Polyclonal NF kappaB p105/p50 antibody</p>

<p>The MKK3 antibody is a highly specialized product used in the field of Life Sciences. This antibody has the unique ability to neutralize epidermal growth factor and exhibit cytotoxic effects on mycoplasma genitalium. It is commonly used in research laboratories for various applications, including lysis assays, protein analysis, and immunohistochemistry studies.</p>

<p>Mouse monoclonal SH2D2A antibody</p>

<p>GNL3 antibody was raised in Rabbit using Human GNL3 as the immunogen</p>

<p>TXNDC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE</p>

<p>ADD3 antibody was raised in Rabbit using Human ADD3 as the immunogen</p>

<p>Rabbit polyclonal RPL15 antibody (FITC)</p>

<p>TPI1 antibody was raised using the N terminal of TPI1 corresponding to a region with amino acids MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID</p>

<p>Purified Polyclonal ABHD9 antibody</p>

<p>Rabbit polyclonal AKT1/3 antibody (Tyr437/434)</p>

<p>The E Cadherin antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets E-cadherin, a protein involved in cell adhesion and cell signaling. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and flow cytometry. It has been shown to have antiviral properties and can neutralize the activity of certain growth factors and chemokines. Additionally, the E Cadherin antibody has been used in studies involving granulosa cells and colony-stimulating factor. Its high specificity and affinity make it a valuable tool for researchers in the field of Life Sciences.</p>

<p>The iNOS antibody is a specific antibody that targets inducible nitric oxide synthase (iNOS), an enzyme involved in the production of nitric oxide. This antibody has been shown to be highly effective in detecting and quantifying iNOS expression in various biological samples. It can be used for research purposes in fields such as life sciences, immunology, and cell biology.</p>

<p>Rabbit polyclonal PSMD2 antibody</p>

<p>Mouse monoclonal IFT57 antibody</p>

<p>IMPA1 antibody was raised using the middle region of IMPA1 corresponding to a region with amino acids IVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE</p>