Primary Antibodies

<p>SEMA6D antibody was raised using the N terminal of SEMA6D corresponding to a region with amino acids VSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLY</p>

<p>Scara3 antibody was raised in rabbit using the middle region of Scara3 as the immunogen</p>

<p>F7 antibody was raised in rabbit using the C terminal of F7 as the immunogen</p>

<p>IQCB1 antibody was raised in rabbit using the C terminal of IQCB1 as the immunogen</p>

<p>ZBTB9 antibody was raised in rabbit using the N terminal of ZBTB9 as the immunogen</p>

<p>ZNF785 antibody was raised in rabbit using the N terminal of ZNF785 as the immunogen</p>

<p>ZNF322A antibody was raised in rabbit using the N terminal of ZNF322A as the immunogen</p>

<p>SMYD3 antibody was raised in rabbit using the C terminal of SMYD3 as the immunogen</p>

<p>SSX6 antibody was raised in rabbit using the middle region of SSX6 as the immunogen</p>

<p>Abcc12 antibody was raised in rabbit using the middle region of Abcc12 as the immunogen</p>

<p>The HA tag antibody is a valuable tool in the field of Life Sciences. It is commonly used to detect and study proteins that have been tagged with the HA epitope. The HA tag, derived from the influenza hemagglutinin protein, consists of a short peptide sequence (YPYDVPDYA) that can be easily recognized by specific antibodies.</p>

<p>CBLN1 antibody was raised in rabbit using the C terminal of CBLN1 as the immunogen</p>

<p>ALAD antibody was raised in rabbit using the N terminal of ALAD as the immunogen</p>

<p>Aquaporin 10 antibody was raised using the middle region of AQP10 corresponding to a region with amino acids VGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECK</p>

<p>OSMR antibody was raised using the middle region of OSMR corresponding to a region with amino acids LLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGYH</p>

<p>CDC45L antibody was raised using a synthetic peptide corresponding to a region with amino acids VTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAED</p>

<p>C9ORF4 antibody was raised using the middle region of C9Orf4 corresponding to a region with amino acids HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVP</p>

<p>STAT5B antibody was raised in rabbit using the N terminal of STAT5B as the immunogen</p>

<p>NAP2 antibody was raised in rabbit using highly pure recombinant hNAP-2 as the immunogen.</p>

<p>Ccbe1 antibody was raised in rabbit using the C terminal of Ccbe1 as the immunogen</p>

<p>The Biotin antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that plays a crucial role in biochemical and immunological research. This antibody is widely used for various applications, including the detection and quantification of biotinylated molecules in biological samples.</p>

<p>GM-CSF antibody was raised in rabbit using highly pure recombinant murine GM-CSF as the immunogen.</p>

<p>Albumin antibody was raised using the middle region of ALB corresponding to a region with amino acids LSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKE</p>

<p>CD137L antibody was raised in rabbit using highly pure recombinant human 4-1BBL as the immunogen.</p>

<p>IL15 antibody was raised using the N terminal of IL15 corresponding to a region with amino acids RISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWV</p>

<p>PLA2G5 antibody was raised using the middle region of PLA2G5 corresponding to a region with amino acids YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC</p>

<p>ATP6V0A2 antibody was raised using the N terminal of ATP6V0A2 corresponding to a region with amino acids INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN</p>

<p>Tdp1 antibody was raised in rabbit using the middle region of Tdp1 as the immunogen</p>

<p>SIL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KETKAEEELDAEVLEVFHPTHEWQALQPGQAVPAGSHVRLNLQTGEREAK</p>

<p>PCDHA10 antibody was raised using the N terminal of PCDHA10 corresponding to a region with amino acids ESRLLDSRFPLEGASDADVGENALLTYKLSPNEYFVLDIINKKDKDKFPV</p>

<p>TBK1 antibody was raised using the middle region of TBK1 corresponding to a region with amino acids QEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQ</p>

<p>SYT11 antibody was raised in rabbit using the N terminal of SYT11 as the immunogen</p>

<p>GZMA antibody was raised in rabbit using the C terminal of GZMA as the immunogen</p>

<p>Beta Tubulin antibody was raised using the N terminal of TUBB corresponding to a region with amino acids YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIF</p>

<p>The AGPAT4 antibody is a monoclonal antibody designed for hybridization in the field of Life Sciences. It specifically targets and activates the AGPAT4 protein, which plays a crucial role in various biological processes. This antibody has been shown to interact with oncostatin, osteopontin, basic protein, e-cadherin, serum albumin protein, and β-catenin. By binding to these proteins, the AGPAT4 antibody can modulate their expression and function. Additionally, this antibody has demonstrated high specificity and affinity for human serum samples. It can be used in various research applications such as Western blotting, immunohistochemistry, and ELISA assays. The AGPAT4 antibody is an invaluable tool for scientists studying cellular signaling pathways and investigating potential therapeutic targets.</p>

<p>PHF6 antibody was raised in rabbit using the C terminal of PHF6 as the immunogen</p>

<p>NUFIP2 antibody was raised in rabbit using the N terminal of NUFIP2 as the immunogen</p>

<p>Scamp1 antibody was raised in rabbit using the N terminal of Scamp1 as the immunogen</p>

<p>TAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL</p>

<p>GPR161 antibody was raised using the middle region of GPR161 corresponding to a region with amino acids  SISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLE</p>

<p>PALM antibody was raised in rabbit using the N terminal of PALM as the immunogen</p>

<p>LAIR2 antibody was raised using the N terminal of LAIR2 corresponding to a region with amino acids SPHLTALLGLVLCLAQTIHTQEGALPRPSISAEPGTVISPGSHVTFMCRG</p>

<p>PIK3R5 antibody was raised in rabbit using the middle region of PIK3R5 as the immunogen</p>

<p>C9orf95 antibody was raised in rabbit using the N terminal of C9orf95 as the immunogen</p>

<p>SLC5A4 antibody was raised in rabbit using the middle region of SLC5A4 as the immunogen</p>

<p>MCM8 antibody was raised using the N terminal of MCM8 corresponding to a region with amino acids ELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPH</p>

<p>Nucleobindin 1 antibody was raised using the C terminal of NUCB1 corresponding to a region with amino acids PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL</p>

<p>SSX1 antibody was raised in rabbit using the middle region of SSX1 as the immunogen</p>

<p>ZNF660 antibody was raised in rabbit using the N terminal of ZNF660 as the immunogen</p>

<p>UCHL5 antibody was raised in rabbit using the middle region of UCHL5 as the immunogen</p>