Primary Antibodies

<p>CD5 antibody (FITC) was raised in rat using CD5/Lyt-1 as the immunogen.</p>

<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>

<p>CD11b antibody (FITC) was raised in rat using peritoneal macrophages from C57 B1/6 x DBA/2 F1 hybrid mice as the immunogen.</p>

<p>CD45.1 antibody (PE-CY7) was raised in mouse using CD45.1 as the immunogen.</p>

<p>CD90 antibody (Spectral Red) was raised in rat using murine T-Cell hybridoma c6/G8, produced by fusion of porl insulin-specific BALB/c T cells with the AKR thymoma line BW 5147 as the immunogen.</p>

<p>CD16 antibody (PE) was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)</p>

<p>CD106 antibody (PE) was raised in Mouse using human CD106/VCAM-1 as the immunogen.</p>

<p>CD71 antibody (PE) was raised in mouse using human CD71 as the immunogen.</p>

<p>CD11a antibody (Azide free) was raised in mouse using human CD11a (LFA-1a) as the immunogen.</p>

<p>CD45RB antibody was raised in rat using cloned mouse Th2 cell lines as the immunogen.</p>

<p>CD28 antibody (biotin) was raised in mouse using chicken CD28 as the immunogen.</p>

<p>CD3e antibody (PE) was raised in hamster using H-2Kb-specific mouse cytotoxic T lymphocyte as the immunogen.</p>

<p>CD3e antibody (PE) was raised in rat using CD3e as the immunogen.</p>

<p>CD56 antibody (Spectral Red) was raised in mouse using human CD56 as the immunogen.</p>

<p>CD11a antibody (biotin) was raised in rat using murine CD11a (LFA-1a) as the immunogen.</p>

<p>CD11b antibody (FITC) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.</p>

<p>KLRG1 antibody (Azide free) was raised in hamster using activated NK (A-LAK) cells from B6 mice as the immunogen.</p>

<p>CD38 antibody (FITC) was raised in rat using CD38 as the immunogen.</p>

<p>CD49b antibody (FITC) was raised in rat using RIL-2-propagated NK1.1+ cells from C57BL/6 mice as the immunogen.</p>

<p>CD11c antibody (biotin) was raised in mouse using human rheumatoid synovial fluid cells/monocytes as the immunogen.</p>

<p>CD107a antibody (Allophycocyanin) was raised in rat using murine CD107a (LAMP-1) as the immunogen.</p>

<p>CD11b antibody (Allophycocyanin) was raised in rat using C57BL/10 murine splenic T cells and concanavalin A-activated C57BL/10 splenocytes as the immunogen.</p>

<p>ApoC-I antibody was raised in goat using full-length recombinant apolipoprotein type C-I produced as the immunogen.</p>

<p>CD11a antibody (Azide Free) was raised in rat using murine CD11a (LFA-1a) as the immunogen.</p>

<p>CD8a antibody (Spectral Red) was raised in rat using murine thymus or spleen as the immunogen.</p>

<p>CD80 antibody (FITC) was raised in mouse using transformed B Lymphoblastoid cells as the immunogen.</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>CD45.2 antibody (PE-CY5.5) was raised in mouse using CD45.2 as the immunogen.</p>

<p>CD45.2 antibody (biotin) was raised in mouse using CD45.2 as the immunogen.</p>

<p>CD19 antibody (Allophycocyanin) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.</p>

<p>CD8a antibody (PE) was raised in mouse using the alpha chain of chicken CD8a as the immunogen.</p>

<p>CD21 antibody (PE) was raised in mouse using porcine CD21 as the immunogen.</p>

<p>CD31 antibody (FITC) was raised in rat using murine leukocyte cell line 32D as the immunogen.</p>

<p>ApoC-III antibody was raised in goat using produced from apolipoprotein type C-III derived from human plasma as the immunogen.</p>

<p>CD16 antibody (PE-CY7) was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)</p>

<p>CD45R antibody (biotin) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.</p>

<p>CD80 antibody (Spectral Red) was raised in rat using CD80/B7-1 as the immunogen.</p>

<p>CD51 antibody (PE) was raised in mouse using human CD51 as the immunogen.</p>

<p>CD49e antibody (FITC) was raised in rat using C57BL/6 x A/J F1 murine mast cell line MC/9 as the immunogen.</p>

<p>E. coli O157 antibody (FITC) was raised in mouse using 'O' antigen of E. coli serotype O157 as the immunogen.</p>

<p>CD69 antibody (FITC) was raised in hamster using Y245 murine dendritic epidermal T cell line as the immunogen.</p>

<p>The PFKP antibody is a specific antibody used in Life Sciences research. It is designed to target and detect the presence of the PFKP protein, a polymorphic glycoprotein involved in syncytia formation. This antibody can be used in various applications such as immunoblotting, immunohistochemistry, and flow cytometry. The PFKP antibody has been validated for use with human serum samples and has shown high specificity and sensitivity. It can be used in conjunction with lectins or other glycan-binding proteins for further analysis. This monoclonal antibody is available as magnetic particles conjugated with the PFKP-specific antibody, allowing for easy separation and purification of target molecules. With its high affinity and specificity, this PFKP antibody is an essential tool for researchers studying the function and regulation of this important protein in various biological systems.</p>

<p>The ApoER2 antibody is a highly specific reagent used in Life Sciences research. It is produced by a hybridoma cell line and targets the ApoER2 molecule. This monoclonal antibody has been extensively tested and validated for its reactivity against dopamine, endogenous protein kinase, inhibitor p21, IL-2 receptor, and other relevant targets.</p>

<p>RASGEF1C antibody was raised using the middle region of RASGEF1C corresponding to a region with amino acids FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESE</p>

<p>SERINC2 antibody was raised in rabbit using the middle region of SERINC2 as the immunogen</p>

<p>ABRA antibody was raised in rabbit using the middle region of ABRA as the immunogen</p>

<p>CDH12 antibody was raised using a synthetic peptide corresponding to a region with amino acids DTQEGVIKLKKPLDFETKKAYTFKVEASNLHLDHRFHSAGPFKDTATVKI</p>

<p>TNF beta antibody was raised in rabbit using highly pure recombinant human TNF-beta as the immunogen.</p>

<p>MCART6 antibody was raised using the middle region of MCART6 corresponding to a region with amino acids WPVLARNSLGSALYFSFKDPIQDGLAEQGLPHWVPALVSGSVNGTITCLV</p>

<p>ZNF169 antibody was raised in rabbit using the middle region of ZNF169 as the immunogen</p>