Primary Antibodies

<p>Lipoprotein Lipase Monoclonal Antibody BSA/Azide Free</p>

<p>Akt, also known as Protein Kinase B (PKB), is a vital cellular signaling protein that governs key processes such as cell growth, survival, metabolism, and proliferation. It operates within the PI3K/Akt pathway, a major signaling route activated by growth factors and hormones like insulin to promote cell survival and growth. When activated, Akt is recruited to the cell membrane and phosphorylated by kinases, including PDK1, which fully activates it. Once active, Akt influences various downstream pathways to inhibit apoptosis, support cell growth via the mTOR pathway, and enhance glucose metabolism, which is crucial for insulin response.In diseases like cancer and diabetes, Akt’s role is particularly significant. Cancer frequently involves dysregulation of the Akt pathway, often through mutations in pathway components like PI3K, PTEN, or Akt itself, leading to increased cell survival, unchecked growth, and resistance to treatment. In diabetes, insulin resistance reduces Akt pathway activity, impairing glucose uptake and raising blood glucose levels. Because of these regulatory effects on cell growth and metabolism, the Akt pathway is a central target in therapeutic research for treating conditions where its influence is disrupted.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, which ultimately inhibits bacterial growth. Its efficacy has been demonstrated through various scientific techniques such as transcription-quantitative polymerase chain and patch-clamp technique. The drug undergoes several metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside exhibits high affinity for markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>SLC22A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR</p>

<p>The CDK4 antibody is a powerful tool used in immunohistochemistry to study the G1 phase of the cell cycle. It is a monoclonal antibody that specifically targets cyclin-dependent kinase 4 (CDK4), a key regulator of cell division. By inhibiting CDK4, this antibody helps researchers understand the role of this kinase inhibitor in cell cycle progression and its potential as a therapeutic target.</p>

<p>ATP6V1E2 antibody was raised using the middle region of ATP6V1E2 corresponding to a region with amino acids LMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLV</p>

<p>Purified Rabbit polyclonal PLCB4 antibody</p>

<p>Rabbit polyclonal KLK11 antibody</p>

<p>HSD11B2 antibody was raised in Rabbit using Human HSD11B2 as the immunogen</p>

<p>Mouse monoclonal METTL21A antibody</p>

<p>The MUTYH antibody is a highly specialized serum marker used in the field of Life Sciences. It is an antibody that specifically targets and binds to the methyl transferase enzyme known as MUTYH. This enzyme plays a crucial role in DNA repair processes, ensuring the integrity of our genetic material.</p>

<p>SFRS2B antibody was raised using the middle region of SFRS2B corresponding to a region with amino acids YRESRYGGSHYSSSGYSNSRYSRYHSSRSHSKSGSSTSSRSASTSKSSSA</p>

<p>The Leptin antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and binds to Leptin, a hormone involved in various physiological processes such as appetite regulation, energy balance, and metabolism. This antibody has been extensively studied and proven to be highly effective in experiments involving Leptin-related assays.</p>

<p>KATNA1 antibody was raised in Rabbit using Human KATNA1 as the immunogen</p>

<p>ERK 1/2 antibody was raised in Mouse using a purified recombinant fragment of human MAPK1 expressed in E. coli as the immunogen.</p>

<p>The Calnexin antibody is a growth factor that has various applications in the field of Life Sciences. It can be used in research studies involving trastuzumab, insulin, and anti-HER2 antibodies. This antibody specifically targets the thymidylate amino group in proteins and is commonly used for detecting and quantifying specific proteins of interest. The Calnexin antibody is a monoclonal antibody that recognizes the carbonyl group on proteins and can be utilized in various assays such as Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). It is also used to detect autoantibodies or Polyclonal Antibodies against specific proteins. With its wide range of applications, the Calnexin antibody is an essential tool for researchers in the Life Sciences field.</p>

<p>The Cytokeratin 8 antibody is a highly specific and sensitive monoclonal antibody used in Life Sciences research. It is designed for the quantitation and detection of activated cytokeratin 8 in various applications, including immunoblotting, immunohistochemistry, and immunofluorescence.</p>

<p>Tektin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RTKLLSLKLSHTRLEARTYRPNVELCRDQAQYGLTDEVHQLEATIAALKQ</p>

<p>PGDS antibody was raised using the N terminal of PGDS corresponding to a region with amino acids PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKI</p>

<p>The 53BP1 antibody is a monoclonal antibody that specifically targets protein tyrosine kinases and interferon. It is a potent inducer of apoptosis, making it an effective tool for studying cell death pathways in various research fields, particularly in Life Sciences. This antibody has been extensively tested and validated for its high specificity and sensitivity in detecting 53BP1 protein expression.</p>

<p>Rabbit polyclonal CYP2W1 antibody</p>

<p>Karyopherin Alpha 6 antibody was raised using a synthetic peptide corresponding to a region with amino acids STTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTP</p>

<p>LAT antibody is an antigen that specifically targets the oncostatin M receptor (OSMR) and inhibits its activity. OSMR is a transmembrane receptor that is expressed on various cell types, including liver microsomes. LAT antibody has been shown to block the interaction between OSMR and its ligand, oncostatin M, thereby preventing downstream signaling events. This antibody has also been demonstrated to inhibit the activation of β-catenin, a key component of the Wnt signaling pathway. In addition to its role in cancer research, LAT antibody is widely used in life sciences for immunohistochemistry and western blotting applications. It is available as both polyclonal and monoclonal antibodies and can be used in combination with other inhibitors or tyrosine kinase inhibitors for more comprehensive studies.</p>

<p>Protein kinase B (also known as RAC-alpha serine/threonine-protein kinase: Atk) is a serum and glucocorticoid-regulated protein kinase with three highly homologous isoforms (Akt1, 2 and 3). Akt1 and Akt3 are the predominant isoforms expressed in the brain, whereas Akt2 is mainly expressed in skeletal muscle and embryonic brown fat. These proteins play major regulatory roles in a range of physiological processes including: growth, proliferation, cell survival, angiogenesis, metabolism and Akt is also considered a proto-oncogene.Dysregulation in the Akt pathway is frequently associated with diseases like cancer and diabetes; mutations in pathway components such as PI3K, PTEN, or Akt itself can result in enhanced cell survival, uncontrolled growth, and resistance to treatment in cancer, as well as impaired glucose uptake in diabetes. Given its central role in these processes, Akt is a primary target in therapeutic research focused on regulating growth and metabolism.</p>

<p>Rabbit polyclonal SRGAP3 antibody</p>

<p>The USP22 antibody is a highly specialized product in the field of Life Sciences. It is an acidic glycosylation agent that is commonly used in research related to insulin, adipose tissue, and interferon. This antibody plays a crucial role in studying the function of adipocytes and their impact on various physiological processes. It has been shown to modulate e-cadherin expression, which is important for cell adhesion and tissue integrity.</p>

<p>Rabbit polyclonal RPA4 antibody</p>

<p>Rabbit polyclonal OR8S1 antibody</p>

<p>The CYP1A2 antibody is a highly specialized product used in Life Sciences research. It is designed to target and detect messenger RNA (mRNA) expression levels of the CYP1A2 gene. This antibody has been extensively tested and validated using rat liver microsomes, as well as human liver microsomal and hepatocyte samples.</p>

<p>Rabbit polyclonal SPIRE1 antibody</p>

<p>UBR2 antibody was raised using the C terminal of UBR2 corresponding to a region with amino acids QGLRRGNPLHLCKERFKKIQKLWHQHSVTEEIGHAQEANQTLVGIDWQHL</p>

<p>Rhotekin antibody was raised using the N terminal of RTKN corresponding to a region with amino acids DSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLG</p>

<p>Rabbit polyclonal SPHK2 antibody</p>

<p>The TMEM27 antibody is a highly versatile and potent medicament that plays a crucial role in various biological processes. This polyclonal antibody specifically targets the transmembrane protein 27 (TMEM27), which is involved in numerous cellular functions.</p>

<p>Rabbit polyclonal TIP60 antibody (Ser86)</p>

<p>Rabbit polyclonal PFKFB2 antibody</p>

<p>UBE2L3 antibody was raised using the C terminal of UBE2L3 corresponding to a region with amino acids IQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD</p>

<p>Rabbit polyclonal Opioid Receptor theta antibody (Ser363)</p>

<p>E. coli antibody was raised in mouse using a pool of E. coli serotypes O18, O44, O112 , and O125, as the immunogen.</p>

<p>The BAD antibody is a highly effective neutralizing agent used in Life Sciences research. It belongs to the class of inhibitors known as antibodies and has been specifically designed to target c-myc and androgen receptors. This monoclonal antibody has the ability to bind to nuclear proteins and inhibit their activity, making it a valuable tool for studying epidermal growth factor signaling pathways. Additionally, the BAD antibody can be used in protein complex studies, as it can effectively disrupt the interaction between growth factors and their receptors. Whether you're conducting basic research or developing therapeutic strategies, this high-quality antibody is an essential tool for your laboratory.</p>

<p>FABP7 antibody was raised in mouse using recombinant human FABP7 (1-132aa) purified from E. coli as the immunogen.</p>

<p>The Chl1 antibody is a polyclonal antibody that specifically targets β-catenin, a key protein involved in cell adhesion and signaling pathways. This antibody has neutralizing properties, meaning it can block the activity of β-catenin and prevent its interaction with other proteins. It can be used for various applications such as immobilization on surfaces for protein-protein interaction studies or as a tool to detect β-catenin levels in human samples. Additionally, the Chl1 antibody has been shown to have cytotoxic effects on certain cancer cells, making it a potential therapeutic agent. With its specificity and versatility, this antibody is an invaluable tool for researchers in the Life Sciences field.</p>

<p>The GPR101 antibody is a powerful tool in the field of biomedical research. This polyclonal antibody specifically targets GPR101, a surface glycoprotein that plays a crucial role in various physiological processes. The antibody is conjugated with an isothiocyanate, allowing for easy detection and visualization of GPR101 in experimental settings.</p>

<p>The MAD2 antibody is a powerful tool for ultrasensitive detection and neutralizing protein carbonyls. This antibody, available in both polyclonal and monoclonal forms, specifically targets fibrinogen and can be immobilized on an electrode for easy use in various applications. It has been extensively validated for its effectiveness in detecting reactive protein carbonyls in human serum samples. Additionally, the MAD2 antibody has shown promising results in the field of stem cell research, particularly with mesenchymal stem cells. Its high specificity and sensitivity make it an ideal choice for researchers looking to study protein carbonylation or develop diagnostic assays for diseases such as carbamazepine-induced hypersensitivity reactions.</p>

<p>Mouse monoclonal TMED1 antibody</p>

<p>The MYBPC3 antibody is a cytotoxic monoclonal antibody that specifically targets the MYBPC3 protein. This protein plays a crucial role in regulating cardiac muscle contraction and is associated with various cardiac disorders. The MYBPC3 antibody has been extensively studied in Life Sciences research and has shown promising results in inhibiting the activity of this target molecule.</p>

<p>1. 6-Fluoro-3-indoxyl-beta-D-galactopyranoside:</p>

<p>MPHOSPH6 antibody was raised in Rabbit using Human MPHOSPH6 as the immunogen</p>

<p>WDR5 antibody was raised in Mouse using a purified recombinant fragment of human WDR5 expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal CD54 antibody (biotin)</p>