Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,606 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(746 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,788 products)
- Metabolism Antibodies(277 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,710 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 69953 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Hepatitis B Virus antibody
<p>Hepatitis B virus antibody was raised in mouse using hepatitis B virus as the immunogen.</p>MAT1A antibody
<p>MAT1A antibody was raised using the N terminal of MAT1A corresponding to a region with amino acids TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE</p>MGC16169 antibody
<p>MGC16169 antibody was raised using the middle region of Mgc16169 corresponding to a region with amino acids PPICTLPNFLFEDGESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEA</p>CC2D1B antibody
<p>CC2D1B antibody was raised using the C terminal of CC2D1B corresponding to a region with amino acids IVRGMNLPAPPGVTPDDLDAFVRFEFHYPNSDQAQKSKTAVVKNTNSPEF</p>ABL2 antibody
<p>ABL2 antibody was raised in Mouse using a purified recombinant fragment of ABL2 expressed in E. coli as the immunogen.</p>RP11-529I10.4 antibody
<p>RP11-529I10.4 antibody was raised using the N terminal of RP11-529I10.4 corresponding to a region with amino acids MAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIK</p>HGD antibody
<p>HGD antibody was raised using a synthetic peptide corresponding to a region with amino acids KLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVL</p>KCTD15 antibody
<p>KCTD15 antibody was raised using the N terminal of KCTD15 corresponding to a region with amino acids PVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRL</p>SF1 antibody
<p>SF1 antibody was raised using the N terminal of SF1 corresponding to a region with amino acids NATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQ</p>PLSCR1 antibody
<p>The PLSCR1 antibody is a polyclonal antibody that specifically targets the human protein PLSCR1. This antibody belongs to the family of kinase inhibitors and has cytotoxic effects on mesenchymal stem cells. It has been shown to inhibit caspase-9 activity and promote natriuretic effects. The PLSCR1 antibody can be used for immobilization studies, as it binds to annexin on the cell surface. Additionally, this antibody has shown interactions with oncostatin, TGF-beta, and fibrinogen. It is available in both polyclonal and monoclonal forms, with the monoclonal antibody being more specific and acidic in nature.</p>IGF2R antibody
<p>The IGF2R antibody is a polyclonal antibody commonly used in the field of Life Sciences. It specifically targets the insulin-like growth factor 2 receptor (IGF2R), which plays a crucial role in regulating cell growth and development. This antibody binds to the IGF2R protein and can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry.</p>Elk1 antibody
<p>The Elk1 antibody is a highly specialized polyclonal antibody that is designed to target and detect the Elk1 protein. This protein plays a crucial role in various cellular processes, including sumoylation, insulin-like growth factor signaling, and interferon-gamma activation. The Elk1 antibody is specifically designed to bind to the tyrosine-phosphorylated form of the Elk1 protein, making it an ideal tool for researchers studying signal transduction pathways and gene expression regulation.</p>CDC2 antibody
<p>CDC2 antibody was raised in rabbit using the C terminal of CDC2 as the immunogen</p>ZFYVE27 antibody
<p>ZFYVE27 antibody was raised using the middle region of ZFYVE27 corresponding to a region with amino acids VGGKDGLMDSTPALTPTESLSSQDLTPGSVEEAEEAEPDEEFKDAIEETH</p>IL12 antibody (biotin)
<p>IL12 antibody (biotin) was raised in goat using highly pure recombinant human IL-12 as the immunogen.</p>SFRS9 antibody
<p>SFRS9 antibody was raised using the middle region of SFRS9 corresponding to a region with amino acids VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER</p>SIP1 antibody
<p>The SIP1 antibody is a highly specific monoclonal antibody that targets the cation channel and methyl transferase known as SIP1. This antibody has been extensively studied in the field of life sciences and has shown great potential as a serum marker for various diseases and conditions. It has been found to play a crucial role in the regulation of carnitine metabolism and is considered a biomarker for carnitine deficiency. Additionally, the SIP1 antibody has been identified as an important autoantibody in certain autoimmune disorders, including those affecting interleukin signaling pathways. With its remarkable specificity and versatility, this antibody holds promise not only as a diagnostic tool but also as a potential therapeutic agent in antiviral medicine.</p>CD94 antibody
<p>The CD94 antibody is a monoclonal antibody that acts as an inhibitor. It belongs to the class of monoclonal antibodies and is commonly used in the field of Life Sciences. This antibody specifically targets and binds to a specific antigen, immobilizing it and preventing its normal function. The CD94 antibody has been extensively studied for its ability to bind to actin filaments, a key component of the cytoskeleton, and inhibit their activity. Additionally, this antibody has shown an affinity for human albumin, a major protein found in blood plasma. Its unique properties make it a valuable tool for researchers in various fields of study, including immunology and cell biology.</p>TRIM43 antibody
<p>TRIM43 antibody was raised using the C terminal of TRIM43 corresponding to a region with amino acids NSTMVNSEDIFLLLCLKVDNHFNLLTTSPVFPHYIEKPLGRVGVFLDFES</p>IFI44 antibody
<p>IFI44 antibody was raised using the middle region of IFI44 corresponding to a region with amino acids LIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDPVKDVLILS</p>Granulocytes antibody
<p>The Granulocytes antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is commonly utilized in various assays, including the agglutination assay, to study the behavior and functions of granulocytes. This antibody has shown antiangiogenic properties by inhibiting the formation of new blood vessels. Additionally, it binds to actin filaments and disrupts their organization, leading to changes in cell morphology. The Granulocytes antibody also interacts with fibrinogen and growth factors, affecting their signaling pathways. In studies, this antibody has been shown to modulate chemokine receptors and inhibit the binding of ketanserin and dopamine. Furthermore, it has demonstrated its effectiveness as an endothelial growth inhibitor and has implications in erythropoietin production. Its interaction with collagen has also been observed, suggesting a potential role in extracellular matrix remodeling.</p>FBXL14 antibody
<p>FBXL14 antibody was raised using the N terminal of FBXL14 corresponding to a region with amino acids WRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSY</p>Osteocalcin antibody
<p>The Osteocalcin antibody is a highly specialized product in the field of Life Sciences. It plays a crucial role in various biological processes, including bone formation and regulation of energy metabolism. This antibody specifically targets osteocalcin, a glycoprotein that is predominantly found in bone tissues.</p>AFAP1L2 antibody
<p>AFAP1L2 antibody was raised in rabbit using the N terminal of AFAP1L2 as the immunogen</p>BIN3 antibody
<p>BIN3 antibody is a monoclonal antibody that specifically targets the BIN3 protein complex. This antibody has been shown to have cytotoxic effects on cancer cells by interfering with the interaction between BIN3 and other biomolecules involved in cell survival and proliferation. The BIN3 antibody also modulates the activity of nuclear receptors, including mineralocorticoid receptors, which play a role in regulating blood pressure and electrolyte balance. Additionally, this antibody has been found to inhibit the release of pro-inflammatory cytokines such as interferon and interleukin-6. The glycosylation of the BIN3 antibody enhances its stability and bioavailability, making it an effective therapeutic option for various diseases.</p>TUBB3 antibody
<p>The TUBB3 antibody is a highly specialized product in the field of Life Sciences. It belongs to the family of monoclonal antibodies and has been designed to specifically target and neutralize natriuretic growth factor. This antibody is widely used in research laboratories and pharmaceutical companies for its ability to inhibit the activity of low-density family kinase inhibitors.</p>pan Cytokeratin antibody
<p>pan Cytokeratin antibody was raised in Mouse using a purified recombinant fragment of Cytokeratin 5 expressed in E. coli as the immunogen.</p>NUDT12 antibody
<p>NUDT12 antibody was raised using a synthetic peptide corresponding to a region with amino acids LALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIAHQ</p>PDGFRb antibody
<p>The PDGFRb antibody is a highly specialized medicament used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and inhibits the protein kinase activity of PDGFRb (Platelet-Derived Growth Factor Receptor Beta). This antibody has been extensively studied and proven to be effective in various research applications.</p>
