Primary Antibodies

<p>Rabbit polyclonal SYT3 antibody</p>

<p>Tropomodulin 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRT</p>

<p>Rabbit polyclonal TXNL6 antibody</p>

<p>IGSF21 antibody was raised in Rabbit using Human IGSF21 as the immunogen</p>

<p>The NF1 antibody is a polyclonal antibody used in life sciences research. It specifically targets the NF1 protein, which plays a crucial role in regulating cell growth and division. This antibody can be used in various applications such as immunohistochemistry and Western blotting to detect and quantify the expression of NF1 in different tissues or cell types.</p>

<p>Mouse monoclonal CD3 antibody (biotin)</p>

<p>Rabbit polyclonal RPL30 antibody</p>

<p>Rabbit polyclonal RPL37A antibody</p>

<p>ITGB3BP antibody was raised in Rabbit using Human ITGB3BP as the immunogen</p>

<p>Mouse monoclonal Complement D antibody</p>

<p>BRAF antibody is a highly specialized monoclonal antibody that targets the BRAF protein, which plays a crucial role in cell signaling pathways. This antibody specifically binds to the activated form of BRAF, inhibiting its activity and preventing downstream signaling events. It has been extensively studied and proven to be effective in various research areas, particularly in the field of Life Sciences.</p>

<p>The USP5 antibody is a highly specific monoclonal antibody that targets glycan structures on chimeric proteins. It has been extensively used in the field of Life Sciences for various applications, including the detection and quantification of interferon levels in human serum. This antibody exhibits high affinity and specificity towards its target, making it a valuable tool for research and diagnostic purposes.</p>

<p>Mouse monoclonal PDE6G antibody</p>

<p>The ITGB1 antibody is a highly specialized monoclonal antibody that targets the human serum and interferon. It is designed for use in Life Sciences research, particularly in the field of apoptosis-inducing factors. This antibody has been developed using advanced techniques, including magnetic particles and expression plasmids. It specifically binds to metal-binding proteins and necrosis factor-related apoptosis-inducing markers, making it a valuable tool for studying cell death pathways. Additionally, the ITGB1 antibody has shown potential as an erbb2 inhibitor and tnf-related apoptosis-inducing agent. Its multispecific nature allows for versatile applications in various research settings.</p>

<p>Rabbit polyclonal SRP68 antibody</p>

<p>The Androgen Receptor antibody is a highly specific antibody that targets the androgen receptor, a key molecule involved in various biological processes. This antibody is widely used in Life Sciences research as a tool to study and understand the role of androgens in different cellular pathways.</p>

<p>Mouse PMN antibody (FITC) was raised in rabbit using mouse PMNs as the immunogen.</p>

<p>Synaptojanin 1 antibody was raised using the N terminal of SYNJ1 corresponding to a region with amino acids IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR</p>

<p>Rabbit polyclonal SUMO2/3 antibody</p>

<p>Purified Polyclonal MT ND1 antibody</p>

<p>Mouse thrombocyte antibody (FITC) was raised in rabbit using mouse thrombocytes as the immunogen.</p>

<p>Rat monoclonal B7H1 antibody (biotin)</p>

<p>GHITM antibody was raised in Rabbit using Human GHITM as the immunogen</p>

<p>Mouse monoclonal CD10 antibody (FITC)</p>

<p>Rabbit polyclonal NMBR antibody</p>

<p>Purified Rabbit polyclonal GAP antibody (Ser387)</p>

<p>CKMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK</p>

<p>IRF3 antibody was raised in Rabbit using Human IRF3 as the immunogen</p>

<p>Mouse monoclonal Hygromycin phosphotransferase antibody</p>

<p>Mouse monoclonal ATP5B antibody</p>

<p>C5AR1 antibody was raised in Rabbit using Human C5AR1 as the immunogen</p>

<p>Rabbit polyclonal MLH3 antibody</p>

<p>The CRYAB antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets the CRYAB protein, also known as alpha-crystallin B chain. This protein plays a crucial role in various cellular processes, including cytoprotection, chaperone activity, and regulation of apoptosis.</p>

<p>The Vibrio cholerae O1 Ogawa &amp; Inaba antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to the O1 serogroup of Vibrio cholerae, which is responsible for causing cholera. The antibody has been extensively studied and proven to be effective in various applications.</p>

<p>Mouse monoclonal Luteinizing Hormone alpha antibody</p>

<p>Mouse monoclonal IL6 antibody (HRP)</p>

<p>LDHA antibody was raised in Rabbit using Human LDHA as the immunogen</p>

<p>Mouse monoclonal LDLRAP1 antibody</p>

<p>C14orf133 antibody was raised in Rabbit using Human C14orf133 as the immunogen</p>

<p>The SOCS3 antibody is a highly specific monoclonal antibody that has been developed for use in the field of life sciences. It is used to target and neutralize IL-17A, a cytokine involved in inflammatory responses. This specific antibody can be used in various applications, including as a therapeutic agent or as a research tool for studying IL-17A-mediated signaling pathways.</p>

<p>Mouse monoclonal ARHGAP25 antibody</p>

<p>Troponin I antibody (cardiac) was raised in mouse using amino acid residues 186-192 of cTnI as the immunogen.</p>

<p>IFIT3 antibody was raised in Rabbit using Human IFIT3 as the immunogen</p>

<p>HISPPD1 antibody was raised using the middle region of HISPPD1 corresponding to a region with amino acids SLSSCQQRVKARLHEILQKDRDFTAEDYEKLTPSGSISLIKSMHLIKNPV</p>

<p>The Synaptophysin antibody is a highly specialized monoclonal antibody that plays a crucial role in neutralizing the activity of growth factors. It is specifically designed to target and bind to the activated forms of these growth factors, preventing them from exerting their effects. This immobilization of growth factors is essential for regulating various biological processes.</p>

<p>Rabbit polyclonal USP28 antibody</p>

<p>Mouse monoclonal BUB1B antibody</p>

<p>KRT6B antibody was raised in Rabbit using Human KRT6B as the immunogen</p>

<p>Rabbit polyclonal YIPF5 antibody</p>

<p>Syrian Hamster monoclonal CD28 antibody (biotin)</p>