Primary Antibodies

<p>NASP antibody was raised using a synthetic peptide corresponding to a region with amino acids KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV</p>

<p>FBXO5 antibody was raised using the C terminal of FBXO5 corresponding to a region with amino acids ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL</p>

<p>The GATA4 antibody is a highly specific and targeted molecule drug that plays a crucial role in the field of Life Sciences. It is known to regulate various processes such as fatty acid metabolism, insulin production, and plasma levels. This antibody is designed to bind to GATA4, a transcription factor involved in the regulation of gene expression.</p>

<p>Turkey RBC antibody (Texas Red) was raised in rabbit using turkey erythrocytes as the immunogen.</p>

<p>Mouse monoclonal TOM70 antibody</p>

<p>Rabbit polyclonal FOXH1 antibody</p>

<p>MCM5 antibody was raised in Rabbit using Human MCM5 as the immunogen</p>

<p>The ACO2 antibody is a highly specific monoclonal antibody that binds to ACO2, an enzyme involved in the tricarboxylic acid cycle. This antibody has been extensively studied and validated for its use in various research applications in the field of life sciences. It can be used for the detection and quantification of ACO2 in human hepatocytes, as well as for studying the role of ACO2 in cellular processes such as metabolism and energy production. The ACO2 antibody has also been shown to interact with other binding proteins, including interferon and chemokine receptors such as CXCR4. Its immobilization on electrodes allows for efficient detection and analysis of ACO2 levels in biological samples, making it a valuable tool for researchers working in the fields of molecular biology and biochemistry.</p>

<p>Rabbit polyclonal SPRR3 antibody</p>

<p>Purified Polyclonal Cathepsin V antibody</p>

<p>ICK antibody was raised in Rabbit using Human ICK as the immunogen</p>

<p>UNC45A antibody was raised using a synthetic peptide corresponding to a region with amino acids REIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG</p>

<p>Mouse monoclonal ARHGAP25 antibody</p>

<p>Rabbit polyclonal TNR antibody</p>

<p>Rabbit polyclonal RGS14 antibody</p>

<p>Mouse monoclonal HDHD2 antibody</p>

<p>The TGF alpha antibody is a highly effective monoclonal antibody that is used in Life Sciences research. It has been shown to neutralize the activity of TGF-alpha, a potent chemokine that plays a crucial role in cell growth and development. This antibody binds to TGF-alpha and prevents it from activating its receptors, thereby inhibiting downstream signaling pathways. The TGF alpha antibody is colloidal in nature, allowing for easy and efficient delivery into cells. It can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. Additionally, this antibody has been found to have potential therapeutic applications in diseases involving abnormal TGF-alpha signaling, such as certain types of cancer and neurodegenerative disorders. Its high specificity and affinity make it an invaluable tool for researchers studying the role of TGF-alpha in various biological processes.</p>

<p>Rabbit polyclonal Cytochrome P450 39A1 antibody</p>

<p>HPD antibody was raised using the middle region of HPD corresponding to a region with amino acids EMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIV</p>

<p>Integrin alpha 7 antibody is a highly specialized monoclonal antibody that targets the integrin alpha 7 protein. This antibody has been extensively studied and proven to be effective in various applications, including immunoassays, western blotting, immunohistochemistry, and flow cytometry.</p>

<p>The cRel antibody is a monoclonal antibody that specifically targets the nuclear factor cRel. This protein plays a crucial role in various cellular processes, including the regulation of gene expression and immune responses. The cRel antibody can be used in a variety of assays to study the function and localization of this protein. Additionally, it has been shown to have potential therapeutic applications in the field of life sciences. By targeting cRel, this antibody may help researchers gain valuable insights into diseases such as cancer, autoimmune disorders, and inflammatory conditions. Its high specificity and affinity make it a valuable tool for scientists working in the field of molecular biology and immunology.</p>

<p>HSP90B1 antibody was raised in Rabbit using Human HSP90B1 as the immunogen</p>

<p>The CD4 antibody is a highly specific monoclonal antibody that targets the CD4 protein, which is expressed on the surface of certain immune cells. This antibody has been extensively studied and has shown various biological effects. It has been found to inhibit syncytia formation, a process in which infected cells fuse together to form giant multinucleated cells. Additionally, the CD4 antibody can block the interaction between CD4 and its ligands, such as the IL-2 receptor, thereby modulating immune responses.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. With its bactericidal activity, it effectively treats tuberculosis infections. This active compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis, oxidation, reduction, and conjugation, this drug specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Parainfluenza type 3 antibody was raised in mouse using parainfluenza virus, type 3 as the immunogen.</p>

<p>Rabbit polyclonal TMEM120A antibody</p>

<p>The Fn14 antibody is a specific antiserum that has chemotactic activity and can target opioid peptides. It is a monoclonal antibody that is widely used in the field of Life Sciences. The Fn14 antibody has been shown to inhibit androgen biosynthesis, making it a valuable tool in research related to hormone regulation. This antibody specifically binds to the antigen binding domain of Fn14, a protein involved in various cellular processes. It has also been used in studies on steroid metabolites and pleomorphic adenoma. Additionally, the Fn14 antibody can be conjugated to a carbon electrode for electrochemical detection methods, such as phenyl phosphate assays.</p>

<p>The TEX14 antibody is a protein that acts as a growth factor, specifically targeting epidermal growth factor and hepatocyte growth inhibitory factor. It is an essential component in the field of Life Sciences and is widely used in research studies. The TEX14 antibody can be utilized as both a monoclonal and polyclonal antibody, making it versatile for various applications. Its high specificity allows for accurate detection and analysis of c-myc expression levels. Additionally, the TEX14 antibody has been found to be effective in detecting autoantibodies, making it valuable in diagnostic testing. With its robust capabilities, this antibody is an indispensable tool for researchers in the field.</p>

<p>SMC3 antibody was raised in Rat using Mouse SMC3 and GST fusion protein as the immunogen.</p>

<p>LIN7C antibody was raised using a synthetic peptide corresponding to a region with amino acids MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV</p>

<p>Purified Polyclonal Lamin A/C antibody</p>

<p>Tetraspanin 1 antibody was raised using the middle region of TSPAN1 corresponding to a region with amino acids TMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKA</p>

<p>Rabbit polyclonal ISG15 antibody (HRP)</p>

<p>EPO antibody was raised in Mouse using a purified recombinant fragment of human EPO expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal BCAR1 antibody</p>

<p>Rabbit polyclonal OR13H1 antibody</p>

<p>Mouse monoclonal CD105 antibody (allophycocyanin)</p>

<p>Rabbit polyclonal TRIM11 antibody</p>

<p>The SNAP25 antibody is a highly effective tool used in scientific research for the detection and analysis of SNAP25 protein. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.</p>

<p>PTP4A3 antibody was raised using the middle region of PTP4A3 corresponding to a region with amino acids LGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQR</p>

<p>IL15RA antibody was raised in Rabbit using Human IL15RA as the immunogen</p>

<p>HSD3B2 antibody was raised in Rabbit using Human HSD3B2 as the immunogen</p>

<p>RHOB antibody was raised in mouse using recombinant Human Ras Homolog Gene Family, Member B (Rhob)</p>

<p>Purified Polyclonal COX8A antibody</p>

<p>The MCL1 antibody is a growth factor that plays a crucial role in cell survival and apoptosis. It is a monoclonal antibody that specifically targets MCL1, an anti-apoptotic protein. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various assays.</p>

<p>The Amphetamine antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to amphetamine, a powerful stimulant drug. This antibody is designed to detect and quantify the presence of amphetamine in various biological samples.</p>

<p>Mouse monoclonal NUCB1 antibody</p>

<p>FLJ20628 antibody was raised using the N terminal of FLJ20628 corresponding to a region with amino acids PLSISDIGTGCLSSLENLRLPTLREESSPRELEDSSGDQGRCGPTHQGSE</p>

<p>Mouse monoclonal PDE4A antibody</p>

<p>Rabbit polyclonal Cytokeratin 18 antibody (Ser52)</p>