Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,606 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(746 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,727 products)
- Metabolism Antibodies(277 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,710 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 69953 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
ACADM antibody
<p>ACADM antibody was raised using the N terminal of ACADM corresponding to a region with amino acids AAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQAT</p>KCTD10 antibody
<p>KCTD10 antibody was raised using the N terminal of KCTD10 corresponding to a region with amino acids MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTL</p>DUT antibody
<p>DUT antibody was raised using the C terminal of DUT corresponding to a region with amino acids NFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN</p>SHCBP1 antibody
<p>The SHCBP1 antibody is a polyclonal antibody that specifically targets the protein SHCBP1. This antibody has been widely used in various applications, including diagnostics, biomarker discovery, and cellular immunotherapy.</p>C20orf43 antibody
<p>C20orf43 antibody was raised in Rabbit using Human C20orf43 as the immunogen</p>FABP4 antibody
<p>FABP4 antibody was raised in Mouse using a purified recombinant fragment of FABP4 expressed in E. coli as the immunogen.</p>PDLIM2 antibody
<p>The PDLIM2 antibody is a monoclonal antibody that specifically targets and binds to the PDLIM2 protein. This antibody is widely used in life sciences research for various applications, including immunohistochemistry, Western blotting, and flow cytometry. It can be used as a valuable tool to study the function and localization of PDLIM2 in different cell types and tissues. The PDLIM2 antibody is highly specific and sensitive, ensuring accurate and reliable results. It is an essential component in studies related to gene expression, protein-protein interactions, and signal transduction pathways involving PDLIM2. With its high affinity for the target protein, this antibody provides researchers with a powerful tool to advance their understanding of cellular processes and disease mechanisms.</p>RDH10 antibody
<p>The RDH10 antibody is a highly specialized monoclonal antibody that is used for immobilization and colloidal electrode applications. This antibody specifically targets carbamazepine, a commonly used antiepileptic drug. The RDH10 antibody has neutralizing properties, making it an effective tool for detecting and quantifying carbamazepine in human serum samples. Additionally, this antibody has been shown to have ultrasensitive detection capabilities, allowing for accurate measurement of low levels of carbamazepine. The RDH10 antibody can also be used to detect protein carbonyls and autoantibodies in various biological samples. Its specificity and sensitivity make it an invaluable tool in research and diagnostic applications involving mesenchymal stem cells.</p>SNAP25 antibody
<p>The SNAP25 antibody is a highly specific and potent antibody that targets SNAP25, a protein involved in the release of insulin and glucagon. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.</p>DNA PKcs antibody
<p>The DNA PKcs antibody is a highly specialized monoclonal antibody used in Life Sciences research. This antibody specifically targets and binds to DNA-dependent protein kinase catalytic subunit (DNA PKcs), an important enzyme involved in DNA repair and recombination processes. By inhibiting the activity of DNA PKcs, this antibody can be used to study the role of this enzyme in various cellular processes.</p>Progesterone Receptor antibody (Ser190)
<p>Rabbit Polyclonal Progesterone Receptor antibody (Ser190)</p>HIF1 α antibody
<p>The HIF1 alpha antibody is a highly specific polyclonal antibody that is used in life sciences research. It binds to the hypoxia-inducible factor 1 alpha (HIF1α) protein, which plays a crucial role in cellular response to low oxygen levels. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>ZCRB1 antibody
<p>ZCRB1 antibody was raised using the N terminal of ZCRB1 corresponding to a region with amino acids MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKS</p>S100 antibody
<p>S100 antibody was raised in mouse using human brain S-100 protein as the immunogen.</p>PSME3 antibody
<p>PSME3 antibody was raised using the N terminal of PSME3 corresponding to a region with amino acids PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ</p>HER2 antibody
<p>The HER2 antibody is a highly effective monoclonal antibody used in the field of Life Sciences. Specifically, it targets the human epidermal growth factor receptor 2 (HER2), also known as ERBB2. This antibody, commonly referred to as trastuzumab, plays a crucial role in inhibiting the overexpression of HER2 receptors on cancer cells.</p>VTCN1 antibody
<p>The VTCN1 antibody is a polyclonal antibody that is used in life sciences research. It can be used to detect and analyze the expression of VTCN1, a protein involved in various biological processes. This antibody specifically binds to VTCN1 and can be used for applications such as Western blotting, immunohistochemistry, and flow cytometry. In addition, this antibody has neutralizing activity against dopamine and catalase, making it useful for studying the effects of these molecules on cellular processes. The VTCN1 antibody is also used to detect autoantibodies, such as antiphospholipid antibodies, in human serum samples. Its reactive nature allows it to bind to endothelial growth factor and other proteins involved in cell signaling pathways. This antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options depending on their specific experimental needs.</p>GATA4 antibody
<p>The GATA4 antibody is a highly specific monoclonal antibody that is used in various applications within the field of Life Sciences. This cytotoxic antibody is designed to target and bind to GATA4, a transcription factor that plays a crucial role in the regulation of gene expression. By binding to GATA4, this antibody can modulate its activity and potentially inhibit its function.</p>Podocin antibody
<p>The Podocin antibody is a cytotoxic monoclonal antibody used in Life Sciences. It is specifically designed to target VEGF (vascular endothelial growth factor) and inhibit its activity. This antibody has been extensively studied for its glycosylation patterns and its interaction with other growth factors, such as epidermal growth factor. The Podocin antibody has shown promising results in inhibiting the activity of arginase, an enzyme involved in the metabolism of arginine. It can be used in various research applications, including electrophoresis and immunohistochemistry. With its high specificity and affinity, this monoclonal antibody offers a valuable tool for researchers working in the field of growth factors and angiogenesis.</p>HBP1 antibody
<p>The HBP1 antibody is a highly specific and potent antibody that targets a specific protein in the body. It is widely used in the field of Life Sciences for various research purposes. This antibody is designed to bind to the target molecule with high affinity, making it an ideal tool for studying protein function and regulation.</p>
