Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,609 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(746 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,691 products)
- Metabolism Antibodies(278 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,710 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 69953 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
DTNB antibody
<p>The DTNB antibody is a specialized antibody that is used in the field of life sciences. It specifically targets cholinesterase, an enzyme that plays a crucial role in the breakdown of carbamate pesticides and organophosphorus compounds. This antibody can be used for research purposes to study the effects of these compounds on cholinesterase activity. It is also useful for developing diagnostic tests to detect exposure to carbamate pesticides or organophosphorus compounds. The DTNB antibody is a monoclonal antibody, which means it is highly specific and effective in detecting its target molecule. Its use in various applications makes it an essential tool for researchers and professionals working in the field of life sciences.</p>Horse RBC antibody (FITC)
<p>Horse RBC antibody (FITC) was raised in rabbit using eqiune erythrocytes as the immunogen.</p>VTI1B antibody
<p>VTI1B antibody was raised in rabbit using the C terminal of VTI1B as the immunogen</p>KIDINS220 antibody
<p>Affinity purified Rabbit polyclonal KIDINS220 antibody; cross reactive human</p>SYP antibody
<p>SYP antibody was raised in Mouse using a purified recombinant fragment of SYP expressed in E. coli as the immunogen.</p>Tau antibody
<p>The Tau antibody is a monoclonal antibody that targets sclerostin, a protein involved in bone formation. This antibody has been widely used in Life Sciences research to study the role of sclerostin in various biological processes. It can be used in experiments such as Western blotting, immunohistochemistry, and ELISA to detect and quantify sclerostin levels in different samples.</p>CLIP1 antibody
<p>CLIP1 antibody was raised in rabbit using the C terminal of CLIP1 as the immunogen</p>WDR51B antibody
<p>WDR51B antibody was raised using the N terminal of WDR51B corresponding to a region with amino acids GNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATAS</p>IL23 antibody
<p>IL23 antibody is an immunosuppressant that belongs to the class of monoclonal antibodies. It specifically targets IL-23, a cytokine involved in immune responses and inflammation. By binding to IL-23, this antibody prevents its interaction with its receptor, thereby inhibiting the downstream signaling pathways that lead to inflammation. IL23 antibody has been shown to effectively reduce the production of pro-inflammatory cytokines and inhibit the activation of immune cells. This antibody is commonly used in research and clinical settings to study the role of IL-23 in various diseases, including autoimmune disorders and cancer. Its high specificity and potency make it a valuable tool for investigating the therapeutic potential of targeting IL-23 in these conditions.</p>PSTAIR antibody
<p>The PSTAIR antibody is a highly versatile and potent tool in the field of Life Sciences. This monoclonal antibody has been extensively studied and proven to have a wide range of applications. It has shown exceptional binding affinity to various targets, including growth factors, influenza hemagglutinin, collagen, alpha-fetoprotein, fibrinogen, and many more.</p>SSB antibody
<p>The SSB antibody is a highly specific monoclonal antibody that targets and binds to the SSB protein. This antibody has cytotoxic effects on cancer cells, making it a valuable tool in cancer research and treatment. It has been shown to induce apoptosis in cardiomyocytes and inhibit the activation of β-catenin, a key regulator of cell proliferation and differentiation. The SSB antibody also reacts with pancreatic glucagon-producing cells, making it useful for studying pancreatic function and diabetes. Additionally, this antibody can be used in diagnostic tests to detect autoantibodies associated with certain autoimmune diseases. With its high specificity and versatility, the SSB antibody is an essential tool for researchers in the life sciences field.</p>GST antibody
<p>The GST antibody is a highly reactive and cytotoxic monoclonal antibody that is commonly used in Life Sciences research. It specifically targets the glutathione S-transferase (GST) protein, which plays a crucial role in detoxification processes within cells. The GST antibody can be used to detect and quantify GST levels in various samples, including human serum.</p>HSD17B14 antibody
<p>HSD17B14 antibody was raised using a synthetic peptide corresponding to a region with amino acids RVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLD</p>Chlamydia trachomatis antibody
<p>Chlamydia trachomatis antibody was raised in mouse using Chlamydia trachomatis LPS as the immunogen.</p>TACC3 antibody
<p>The TACC3 antibody is a highly specialized monoclonal antibody that has receptor binding capabilities. It acts as a phosphatase, neutralizing specific targets in the body. This antibody is widely used in Life Sciences research and has shown promising results in various studies. It has been found to have an inhibitory effect on alpha-fetoprotein, a protein found in human serum that is associated with certain diseases. The TACC3 antibody can also block the activity of angptl3, a chemokine involved in inflammatory processes. With its immunosuppressant properties, this monoclonal antibody holds great potential for therapeutic applications and further exploration in the field of medicine.</p>LASP1 antibody
<p>The LASP1 antibody is a high-quality polyclonal antibody that specifically targets LASP1, a protein with various important functions in cellular processes. This antibody is widely used in life sciences research to study the role of LASP1 in different biological pathways.</p>PHYHIP antibody
<p>PHYHIP antibody was raised using the N terminal of PHYHIP corresponding to a region with amino acids VSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVFYRNHHKEYFQ</p>TRIM54 antibody
<p>TRIM54 antibody was raised using the N terminal of TRIM54 corresponding to a region with amino acids IYKQESSRPLHSKAEQHLMCEEHEEEKINIYCLSCEVPTCSLCKVFGAHK</p>Pneumocystis carinii antibody
<p>Pneumocystis carinii antibody was raised in mouse using Pneumocystis carinii isolates as the immunogen.</p>CROT antibody
<p>The CROT antibody is a highly specialized monoclonal antibody that targets autoantibodies and has antiviral properties. It is commonly used in high-flux assays and life science research to detect and measure the levels of interleukins, carnitine, and octanoyltransferase. This antibody is designed to specifically bind to CROT protein, inhibiting its activity and preventing the formation of antibodies that can cause autoimmune diseases. With its ability to accurately detect extracellular antibodies, the CROT antibody plays a crucial role in the development of new medicines and therapies targeting autoimmune disorders.</p>RAMP3 antibody
<p>The RAMP3 antibody is a highly specialized monoclonal antibody that targets the serum protein S100B. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cancer and autoimmune disorders.</p>
