Primary Antibodies

<p>Human ERCC6, aa 1144-1493 encoded by BC127103</p>

<p>Rabbit polyclonal ZNF638 antibody</p>

<p>Affinity purified Rabbit polyclonal GLOD4 antibody</p>

<p>The GRP94 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is primarily used for research purposes and has a wide range of applications. This antibody specifically targets and binds to GRP94, which is a member of the heat shock protein 90 (HSP90) family.</p>

<p>Purified Rabbit polyclonal NDUFA9 antibody</p>

<p>The CCL2 antibody is a monoclonal antibody that is used in Life Sciences for its neutralizing properties. It specifically targets and binds to CCL2, which is a chemokine involved in inflammation and immune response. By binding to CCL2, this antibody inhibits its function and prevents the activation of certain immune cells. The CCL2 antibody has been shown to be effective in blocking the activity of interferon-inducible protein 10 (IP-10), which is an inflammatory mediator. This makes it a promising therapeutic option for various diseases where CCL2 plays a role, such as liver inflammation and autoimmune disorders.</p>

<p>UGT1A1 antibody was raised using the middle region of UGT1A1 corresponding to a region with amino acids ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH</p>

<p>The Met antibody is a highly specialized monoclonal antibody that targets the endothelial growth factor. It is commonly used in Life Sciences research to study the role of growth factors in various biological processes. This monoclonal antibody has a high affinity for binding proteins and can effectively neutralize their activity. Additionally, it has been shown to inhibit the formation of protein complexes involved in steroid and growth factor signaling pathways. The Met antibody is also used as a tool in diagnostic assays to detect the presence of specific proteins, such as alpha-fetoprotein or anti-ACTH antibodies. Its versatility and specificity make it an invaluable asset in scientific research and medical applications related to hepatocyte growth and other cellular processes.</p>

<p>The VEGFC antibody is a monoclonal antibody that targets and neutralizes the activity of Vascular Endothelial Growth Factor C (VEGFC). This antibody plays a crucial role in inhibiting the activation of TNF-α, leukemia inhibitory factor, and other oncogenic kinases. By binding to VEGFC, this antibody prevents its interaction with its receptors, thereby inhibiting the signaling pathways involved in angiogenesis and lymphangiogenesis.</p>

<p>Rabbit polyclonal IRS1 antibody (Ser639)</p>

<p>Rabbit polyclonal MEK1 antibody (Thr291)</p>

<p>CD38 antibody (Azide free) was raised in rat using CD38 as the immunogen.</p>

<p>CREBL2 antibody was raised in Rabbit using Human CREBL2 as the immunogen</p>

<p>PRR15 antibody was raised using the middle region of PRR15 corresponding to a region with amino acids GDKSGSSRRNLKISRSGRFKEKRKVRATLLPEAGRSPEEAGFPGDPHEDK</p>

<p>ZPBP2 antibody was raised using the middle region of ZPBP2 corresponding to a region with amino acids VRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLTYG</p>

<p>The EEA1 antibody is a biomolecule that plays a crucial role in the field of Life Sciences. It is an essential component in the study of interferon and interleukin-6, as it acts as an inhibitor for these molecules. The EEA1 antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. This antibody demonstrates neutralizing properties, making it highly effective in assays and experiments where protease activity needs to be inhibited. With its colloidal nature, the EEA1 antibody ensures accurate and reliable results. Researchers can rely on this antibody to enhance their understanding of complex biological processes and advance scientific knowledge in various fields.</p>

<p>The COL4A3 antibody is a polyclonal antibody that specifically targets the rubisco molecule. Rubisco is an enzyme involved in photosynthesis and is found in plants and some bacteria. This antibody has been developed for use in life sciences research and has the ability to neutralize the activity of rubisco. It can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. The COL4A3 antibody is a valuable tool for researchers studying the role of rubisco in plant biology, as well as those investigating potential therapeutic targets for diseases related to rubisco dysfunction. Additionally, this antibody may have potential applications in the development of new drugs or treatments targeting rubisco-related disorders.</p>

<p>Rabbit polyclonal PBOV1 antibody</p>

<p>The MUC16 antibody is a monoclonal antibody that targets the MUC16 protein. This protein, also known as CA125, is a tumor marker that is often elevated in ovarian cancer. The MUC16 antibody specifically binds to the MUC16 protein, inhibiting its interaction with other molecules and preventing tumor growth and progression.</p>

<p>Affinity purified Rabbit polyclonal TULP1 antibody</p>

<p>EDN2 antibody was raised in Rabbit using Human EDN2 as the immunogen</p>

<p>Salmonella antibody (biotin) was raised in rabbit using a mixture of S. enteriditis, S. typhimurium and S. heidelburg as the immunogen.</p>

<p>Rabbit polyclonal ARTS1 antibody</p>

<p>Purified Polyclonal RAB30 antibody</p>

<p>CD31 antibody was raised in mouse using stimulated human Leukocytes as the immunogen.</p>

<p>ACVRL1 antibody was raised in Rabbit using Human ACVRL1 as the immunogen</p>

<p>Purified Rabbit polyclonal HER3 antibody (Tyr1197)</p>

<p>CKMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPA</p>

<p>ACSM3 antibody was raised in Rabbit using Human ACSM3 as the immunogen</p>

<p>The STEAP1 antibody is a highly effective and activated agent that plays a crucial role in various biological processes. It specifically targets vitronectin, an extracellular matrix protein involved in cell adhesion and migration. The STEAP1 antibody has been extensively studied for its ability to neutralize the effects of autoantibodies, which can lead to autoimmune diseases.</p>

<p>Affinity purified Rabbit polyclonal Deltex1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>HOXB9 antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to HOXB9, a protein involved in various biological processes such as collagen synthesis and glycosylation. By inhibiting the activity of HOXB9, this antibody can be used to study its function and impact on cellular processes.</p>

<p>Rabbit polyclonal Beta Enolase antibody</p>

<p>Purified Rabbit polyclonal MPRIP antibody</p>

<p>C4d Complement fragment Monoclonal Antibody</p>

<p>LHRH Antibody is a monoclonal antibody that specifically targets luteinizing hormone-releasing hormone (LHRH). It has been shown to inhibit the activity of LHRH, which plays a crucial role in regulating reproductive functions. This antibody has interferon-like activity and can modulate the release of vasoactive intestinal peptide and colony-stimulating factors. Additionally, it has been demonstrated to enhance the production of interferon-gamma (IFN-gamma) in human serum. LHRH Antibody may also have potential therapeutic applications in the treatment of conditions such as prostate cancer and breast cancer, as it can interfere with the growth-promoting effects of LHRH on tumor cells.</p>

<p>DIRAS3 antibody was raised in Rabbit using Human DIRAS3 as the immunogen</p>

<p>Rabbit polyclonal Ceruloplasmin antibody (FITC)</p>

<p>CD54 antibody was raised in mouse using human monocytes as the immunogen.</p>

<p>U1SNRNPBP antibody was raised using the N terminal of U1SNRNPBP corresponding to a region with amino acids RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR</p>

<p>Rabbit polyclonal NFKP p65 antibody</p>

<p>Rabbit polyclonal GABARAPL2 antibody (biotin)</p>

<p>Rabbit polyclonal OR10G7 antibody</p>

<p>CTSL2 antibody was raised in rabbit using the C terminal of CTSL2 as the immunogen</p>

<p>The VHL antibody is a multidrug monoclonal antibody that specifically targets molecules involved in endothelial growth. It is widely used in Life Sciences research to study the role of growth factors, chemokines, and other signaling molecules in various cellular processes. This antibody has been shown to effectively neutralize the activity of activated growth factors, leading to a decrease in cell proliferation and migration. Additionally, it has demonstrated cytotoxic effects on cancer cells through its ability to induce cell death via various mechanisms, including hybridization and cell cytotoxicity. The VHL antibody is an essential tool for researchers studying angiogenesis, tumor biology, and therapeutic development.</p>

<p>Affinity purified Rabbit polyclonal KLRC4 antibody</p>

<p>Affinity purified Rabbit polyclonal Integrin alpha 2b antibody</p>

<p>The Doublecortin antibody is a highly specialized antibody that is activated by plasmin activity. It is commonly used in Life Sciences research to study protein-protein interactions and proteolytic processes. This antibody specifically targets hepcidin, a peptide hormone involved in iron metabolism, and has been shown to have neuroprotective effects. Additionally, the Doublecortin antibody has been found to inhibit glutamate-induced cell cytotoxicity and fibrinogen binding. It is available as both a monoclonal and polyclonal antibody, allowing researchers to choose the best option for their specific needs. With its high specificity and ability to target specific amino acid residues, the Doublecortin antibody is a valuable tool in various research applications.</p>

<p>RGS20 antibody was raised using the N terminal of RGS20 corresponding to a region with amino acids KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP</p>