Primary Antibodies

<p>PHTF1 antibody was raised in mouse using recombinant Putative Homeodomain Transcription Factor 1</p>

<p>The cMet antibody is a highly specialized antibody that targets the cMet protein, which plays a crucial role in various biological processes. This antibody can effectively bind to collagen, natriuretic peptides, elastase, and lectins, allowing for precise targeting of specific cells or tissues.</p>

<p>The HSPA1A antibody is a monoclonal antibody used in Life Sciences for its antiviral properties. It specifically targets the HSPA1A protein, which is involved in various cellular processes such as stress response and protein folding. This antibody has been shown to neutralize the activity of HSPA1A, making it a valuable tool for research in understanding the role of this protein in different biological contexts.</p>

<p>The SSTR2 antibody is a specific antibody that targets the somatostatin receptor 2 (SSTR2). It is commonly used in research studies involving granulosa cells, as well as in clinical settings for diagnostic purposes. This antibody can be used to detect the presence of SSTR2 in various tissues and cell types. It has also been shown to have potential therapeutic applications, as it can block the activity of SSTR2 and inhibit the growth of certain tumors. The SSTR2 antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the option that best suits their needs. Whether you are studying autoantibodies or investigating the role of SSTR2 in disease pathways, this antibody is a valuable tool for your research.</p>

<p>LASP1 antibody was raised using the C terminal of LASP1 corresponding to a region with amino acids SYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVN</p>

<p>The ROR1 antibody is a powerful biomolecule used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and monoclonal antibodies. This antibody specifically targets the receptor tyrosine kinase-like orphan receptor 1 (ROR1). By binding to ROR1, it inhibits its activity and prevents downstream signaling pathways involved in cell growth and survival.</p>

<p>Rabbit polyclonal AOS1 antibody</p>

<p>CANT1 antibody was raised in Rabbit using Human CANT1 as the immunogen</p>

<p>KIF4A antibody was raised in Rabbit using Human KIF4A as the immunogen</p>

<p>The HDAC3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect HDAC3, a protein involved in various cellular processes. This antibody has been extensively validated and proven to be highly specific and sensitive in detecting HDAC3 levels.</p>

<p>Rabbit polyclonal VAX1 antibody</p>

<p>Mouse monoclonal Human Prolactin antibody (HRP)</p>

<p>The Dopamine Receptor D1 antibody is a monoclonal antibody that specifically targets the dopamine receptor D1. It has been shown to have neutralizing properties and can be used for various applications in research and diagnostics. This antibody has been tested on different cell lines, including MCF-7 carcinoma cell lines, and has demonstrated its effectiveness in blocking the binding of dopamine to its receptor. The use of this antibody can help researchers better understand the role of dopamine receptors in various physiological processes and diseases. It can also be used in immunoassays, such as ELISA or Western blotting, to detect the presence of dopamine receptor D1 in biological samples. With its high specificity and sensitivity, this antibody is a valuable tool for studying dopamine signaling pathways and exploring potential therapeutic interventions targeting this receptor.</p>

<p>Mouse monoclonal PACSIN3 antibody</p>

<p>PINX1 antibody was raised using the N terminal of PINX1 corresponding to a region with amino acids EKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDF</p>

<p>Visfatin antibody was raised in mouse using recombinant human Visfatin (1-491aa) purified from E. coli as the immunogen.</p>

<p>Purified Polyclonal RGS20 antibody</p>

<p>LENG1 antibody was raised in Rabbit using Human LENG1 as the immunogen</p>

<p>Rabbit polyclonal UCHL1 antibody (HRP)</p>

<p>The RBP1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It has antiviral properties and specifically targets the RBP1 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in neutralizing the activity of RBP1.</p>

<p>CIRBP antibody was raised using the middle region of CIRBP corresponding to a region with amino acids GYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHN</p>

<p>Rabbit polyclonal FOS antibody (Thr32)</p>

<p>Cytokeratin 84 antibody was raised using the middle region of KRT84 corresponding to a region with amino acids ESYITNLRRQLEVLVSDQARLQAERNHLQDVLEGFKKKYEEEVVCRANAE</p>

<p>Dynamin 1 antibody was raised using the middle region of DNM1 corresponding to a region with amino acids PPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPA</p>

<p>Rat monoclonal RAE1g antibody (biotin)</p>

<p>HLX antibody was raised in Rabbit using Human HLX as the immunogen</p>

<p>The OVOL1 antibody is a highly activated polyclonal antibody that specifically targets the chemokine OVOL1. This antibody has been extensively studied for its role in oxidative damage and its potential therapeutic applications. It has been shown to interact with various proteins, including erythropoietin, actin filaments, collagen, cationic peptides, superoxide, ketanserin, monoclonal antibodies, endothelial growth factors, androgen receptors, dopamine receptors, and E-cadherin. The OVOL1 antibody offers a promising avenue for further research into the mechanisms of oxidative damage and its potential treatment options.</p>

<p>HIST2H2AC antibody was raised using the middle region of HIST2H2AC corresponding to a region with amino acids IPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAKSK</p>

<p>Rabbit polyclonal RFWD2 antibody</p>

<p>Mouse monoclonal BEST3 antibody</p>

<p>Rabbit polyclonal SYNGAP1 antibody</p>

<p>ISYNA1 antibody was raised in Rabbit using Human ISYNA1 as the immunogen</p>

<p>CK1 alpha 1 antibody was raised using the C terminal of CSNK1A1 corresponding to a region with amino acids HQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF</p>

<p>Rabbit polyclonal TOM1L1 antibody</p>

<p>The MYL6 antibody is a highly specific monoclonal antibody that targets the human serum. It is commonly used in assays and as an inhibitor in various research studies. This antibody specifically binds to collagen and hyaluronic acid, making it an excellent tool for studying these molecules and their interactions. Additionally, the MYL6 antibody has been shown to have cytotoxic effects on adipose tissue, making it a potential candidate for therapeutic applications. It can also be used in the detection of autoantibodies and as a tool to study urokinase plasminogen activator (uPA) signaling pathways. Furthermore, the MYL6 antibody has shown promising results as an anti-ICOS antibody, which could be beneficial in treating conditions related to thrombocytopenia. With its versatility and specificity, the MYL6 antibody is an invaluable tool for researchers in various fields of study.</p>

<p>The ACY1 antibody is a highly specialized monoclonal antibody that has been developed for various applications. It has been shown to be effective in neutralizing the activity of mesenchymal stem cells, making it a valuable tool for research and therapeutic purposes. Additionally, this antibody has demonstrated its ability to target and bind to specific proteins such as anti-mesothelin, fibrinogen, influenza hemagglutinin, and alpha-fetoprotein. This makes it an essential component in diagnostic tests and assays targeting these proteins. The ACY1 antibody has also shown potential antiviral properties, making it a promising candidate for the development of antiviral therapies. Its high specificity and affinity make it an invaluable tool for researchers and clinicians alike in their efforts to understand and combat various diseases and conditions.</p>

<p>Rabbit polyclonal NFKB p105/p50 antibody</p>

<p>Rabbit Polyclonal PSMA1 antibody (Ser250)</p>

<p>Lp-PLA2 monoclonal antibody is a highly specialized antibody used in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Lp-PLA2, an enzyme involved in the inflammation process. By binding to Lp-PLA2, this antibody helps to inhibit its activity, reducing inflammation levels in the body.</p>

<p>The SQSTM1 antibody is a monoclonal antibody that is highly effective in neutralizing the protein SQSTM1. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has been found to inhibit the activation of SQSTM1, which plays a crucial role in several cellular processes. The SQSTM1 antibody can be used for research purposes, such as studying the effects of SQSTM1 on cell growth and differentiation. Additionally, it has shown potential therapeutic benefits in targeting specific diseases associated with abnormal SQSTM1 activity, including certain types of cancer and neurodegenerative disorders. With its high specificity and low density, this monoclonal antibody offers great potential in biomaterials and drug development.</p>

<p>CD4 antibody (PE) was raised in mouse using human CD4 as the immunoge.</p>

<p>Rabbit polyclonal Kinase E9 antibody</p>

<p>Cdc25C antibody was raised in Mouse using a purified recombinant fragment of human Cdc25C expressed in E. coli as the immunogen.</p>

<p>Human serum albumin antibody was raised in mouse using human serum albumin as the immunogen.</p>

<p>Mouse monoclonal LIN7B antibody</p>

<p>RP11-529I10.4 antibody was raised using the middle region of RP11-529I10.4 corresponding to a region with amino acids APLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVD</p>

<p>ROPN1B antibody was raised using the N terminal of ROPN1B corresponding to a region with amino acids DYFEALSRGETPPVRERSERVALCNWAELTPELLKILHSQVAGRLIIRAE</p>

<p>Rabbit polyclonal HSP90B antibody</p>

<p>Mouse monoclonal RALBP1 antibody</p>

<p>Mouse monoclonal SLC7A8 antibody</p>