Primary Antibodies

<p>Rabbit polyclonal RNPEP antibody</p>

<p>The EMA antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to fibrinogen, a glycoprotein involved in blood clotting. This antibody is produced using hybridoma cell lines, which are created by fusing immune cells with tumor cells. The resulting hybridoma cells have the ability to produce large quantities of the EMA antibody.</p>

<p>Rabbit polyclonal RPL26L antibody</p>

<p>Rabbit polyclonal SDCG1 antibody</p>

<p>The FGF2 antibody is a monoclonal antibody that specifically targets and neutralizes fibroblast growth factor 2 (FGF2). It is an ultrasensitive detection tool used in various immunoassays for the detection and quantification of FGF2. This antibody works by binding to FGF2, preventing its interaction with cell surface receptors and inhibiting its signaling pathways. By blocking FGF2 activity, the antibody can inhibit processes such as cell proliferation, angiogenesis, and wound healing that are regulated by FGF2. The FGF2 antibody is widely used in life sciences research, including studies on cancer, cardiovascular diseases, and tissue regeneration. Its high specificity and cytotoxic effects make it an invaluable tool for understanding the role of FGF2 in various biological processes.</p>

<p>Rabbit polyclonal FADD antibody (Ser194)</p>

<p>Rabbit polyclonal ZNF701 antibody</p>

<p>KIF19 antibody was raised in Rabbit using Human KIF19 as the immunogen</p>

<p>Purified Rabbit polyclonal CEP41 antibody</p>

<p>Mouse monoclonal MAPK1 antibody</p>

<p>Rabbit polyclonal Mcleod Syndrome antibody</p>

<p>The V5 Tag antibody is a highly reactive monoclonal antibody that is used in the field of Life Sciences. It specifically targets the V5 epitope tag, which is commonly used in protein research and expression studies. This antibody can be used for various applications such as immunoblotting, immunoprecipitation, and immunofluorescence assays.</p>

<p>The Cry1 antibody is a highly specialized antibody used in Life Sciences research. It specifically targets and binds to the Cry1 protein, which is involved in various cellular processes such as tyrosine phosphorylation and growth factor signaling. This antibody is colloidal gold-conjugated, making it easily detectable in experiments using techniques such as immunohistochemistry or Western blotting.</p>

<p>The SRR antibody is a monoclonal antibody that is specifically designed for the detection and neutralization of insulin. It is commonly used in research and clinical settings to study hyperinsulinaemic hypoglycaemia, a condition characterized by abnormally high levels of insulin in the blood. The SRR antibody is produced through chemical synthesis or recombinant technology using human insulin as the antigen. It has been extensively validated using techniques such as polymerase chain reaction (PCR) and racemase assays to ensure its specificity and reliability. This monoclonal antibody can be used to detect insulin in various samples, including serum, plasma, and tissue extracts. Additionally, it has been shown to have neutralizing activity against insulin, making it a valuable tool for studying the effects of insulin antibodies and autoantibodies in human insulin preparations. With its high affinity for insulin and ability to recognize specific amino acid residues, the SRR antibody offers precise and accurate results for insulin-related research applications.</p>

<p>Rabbit polyclonal MEF2D antibody (Ser444)</p>

<p>The ApoA1 antibody is a monoclonal antibody that plays a crucial role in Life Sciences. It specifically targets and interacts with Apolipoprotein A1 (ApoA1), which is a major component of high-density lipoprotein (HDL) particles. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cardiovascular disorders.</p>

<p>Purified Rabbit polyclonal MOT12 antibody</p>

<p>Rabbit polyclonal SYT4 antibody</p>

<p>RBM26 antibody was raised using the middle region of RBM26 corresponding to a region with amino acids PAALKAAQKTLLVSTSAVDNNEAQKKKQEALKLQQDVRKRKQEILEKHIE</p>

<p>Mouse monoclonal METTL21A antibody</p>

<p>Mouse monoclonal SORD antibody</p>

<p>MGMT antibody was raised in Rabbit using Human MGMT as the immunogen</p>

<p>The HSP40 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to Heat Shock Protein 40 (HSP40), a protein involved in cellular processes such as protein folding and transportation. This antibody recognizes the amino group of HSP40 and can be used for various applications, including immunohistochemistry, Western blotting, and ELISA.</p>

<p>Mouse monoclonal PRKCE antibody</p>

<p>PSMA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREE</p>

<p>EphB1 antibody was raised in Mouse using a purified recombinant fragment of EphB1(aa19-133) expressed in E. coli as the immunogen.</p>

<p>The CD160 antibody is a monoclonal antibody that targets the CD160 protein, which is involved in immune response regulation. It acts as a colony-stimulating factor and plays a role in the activation of macrophages. The CD160 antibody has been extensively studied in the field of Life Sciences and has shown promising results in various experimental models. It has been shown to inhibit the activity of phosphatase enzymes and interfere with interferon signaling pathways. Additionally, it has been found to bind to glutamate receptors and modulate their function. The CD160 antibody is highly specific and exhibits strong binding affinity to its target. It can be used for various applications, including immunohistochemistry, flow cytometry, and Western blotting. This high-quality antibody is suitable for research purposes and is compatible with human serum samples.</p>

<p>Mouse monoclonal TMED1 antibody</p>

<p>Rabbit polyclonal TIMM9 antibody</p>

<p>The REDD1 antibody is a highly specialized product used in Life Sciences research. It is an immunogenic composition designed to target and detect the presence of REDD1 protein in various biological samples. The REDD1 antibody has been extensively tested and validated for its specificity and sensitivity, making it a reliable tool for researchers studying the role of REDD1 in different cellular processes.</p>

<p>Purified Polyclonal Alpha actin 1 antibody</p>

<p>CD144 antibody is a monoclonal antibody that specifically targets CD144, also known as vascular endothelial cadherin (VE-cadherin). It plays a crucial role in maintaining the integrity and stability of endothelial cell-cell junctions. CD144 antibody can be used in various life science research applications, including the study of interleukin-6 signaling, influenza hemagglutinin binding assays, and the detection of reactive oxygen species.</p>

<p>Mouse monoclonal NT5DC1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a highly effective antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. The drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive research using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.</p>

<p>CD11b antibody is a monoclonal antibody that specifically targets CD11b, a cell surface glycoprotein expressed on activated leukocytes. This antibody has antiangiogenic properties and can induce apoptosis in tumor cells by binding to the necrosis factor-related apoptosis-inducing ligand (TRAIL). CD11b antibody can be used in various applications, including immunoprecipitation, Western blotting, and flow cytometry. It has been shown to inhibit the adhesion of leukocytes to endothelial cells and block the migration of leukocytes into inflamed tissues. Additionally, CD11b antibody can be used for the detection of CD11b in nuclear extracts and human serum samples. Its high specificity and affinity make it a valuable tool in Life Sciences research and diagnostic applications.</p>

<p>The Toll-like receptor 2 antibody is a powerful tool in Life Sciences research. It is a monoclonal antibody that specifically targets Toll-like receptor 2 (TLR2), an important component of the innate immune system. TLR2 plays a crucial role in recognizing and responding to microbial pathogens, making it an attractive target for therapeutic interventions.</p>

<p>ITGA4 antibody was raised in Rabbit using Human ITGA4 as the immunogen</p>

<p>Calcitonin antibody was raised in mouse using calcitonin conjugated with carrier protein as the immunogen.</p>

<p>Mouse monoclonal LAMB2 antibody</p>

<p>DIS3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERMLKTAVSEKML</p>

<p>ATG10 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP</p>

<p>SAE1 antibody was raised using the N terminal of SAE1 corresponding to a region with amino acids VTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPE</p>

<p>The BIN3 antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets adipose triglyceride lipase (ATGL), a key enzyme involved in lipid metabolism. This antibody has been extensively studied for its potential therapeutic applications, as well as its role in understanding the mechanisms of obesity and related metabolic disorders.</p>

<p>The SOCS3 antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to neutralize the effects of tumor necrosis factor-alpha (TNF-α) and interferon-gamma (IFN-γ). This antibody is highly specific and has been extensively tested for its efficacy and reliability. The SOCS3 antibody can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. It is supplied with all necessary excipients and can be easily conjugated to streptavidin or other molecules for specific hybridization. This antibody has shown promising results in inhibiting the growth factors associated with certain diseases, making it a valuable tool for researchers studying cytokine signaling pathways.</p>

<p>Rabbit Polyclonal RCAN1 antibody</p>

<p>Mouse monoclonal FOSL1 antibody</p>

<p>GIMAP2 antibody was raised in Rabbit using Human GIMAP2 as the immunogen</p>

<p>MAP4K1 antibody was raised using the N terminal of MAP4K1 corresponding to a region with amino acids VHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATK</p>

<p>The DSG2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to a specific antigen, which plays a crucial role in cell growth and development. This antibody has been extensively tested and proven to be effective in inhibiting the activity of growth factors, thereby preventing the proliferation of certain cells.</p>

<p>The VEGFR2 antibody is a polyclonal antibody that specifically targets the vascular endothelial growth factor receptor 2 (VEGFR2). This receptor plays a crucial role in angiogenesis, which is the formation of new blood vessels. The VEGFR2 antibody binds to VEGFR2 and inhibits its interaction with growth factors, thereby preventing the activation of downstream signaling pathways involved in blood vessel formation.</p>