Primary Antibodies

<p>Desmocollin 1 antibody was raised in mouse using synthetic peptide corresponding to sequence present within the intracellular part of human desmocollin 1 as the immunogen.</p>

<p>SYNCRIP antibody was raised using the middle region of SYNCRIP corresponding to a region with amino acids IEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGG</p>

<p>Rabbit polyclonal OR52E6 antibody</p>

<p>RTP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEA</p>

<p>The LGR4 antibody is a cytotoxic agent that belongs to the family of Life Sciences antibodies. It has shown anti-VEGF (vascular endothelial growth factor) activity and can inhibit the function of tyrosinase, an enzyme involved in melanin production. Additionally, this antibody has neutralizing effects against CD33, a protein expressed on the surface of certain cancer cells. The LGR4 antibody acts as a family kinase inhibitor, blocking the activity of specific kinases involved in cell signaling pathways. It can be used in combination with other antibodies, such as trastuzumab, for targeted cancer therapy. Furthermore, this monoclonal antibody has been shown to have hormone peptide-like properties and can modulate endothelial growth. Its mechanism of action involves binding to specific targets on cells and interfering with their function. The LGR4 antibody may also exhibit anti-inflammatory effects by inhibiting TNF-α (tumor necrosis factor-alpha) production.</p>

<p>CD9 antibody (PE) was raised in mouse using human CD9 as the immunogen.</p>

<p>B3GNT4 antibody was raised using the N terminal of B3GNT4 corresponding to a region with amino acids MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLR</p>

<p>The MKRN1 antibody is a highly specialized polypeptide that targets microvessel endothelial cells. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various biochemical assays. It specifically recognizes and binds to the protein kinase MKRN1, inhibiting its activity and preventing downstream signaling pathways.</p>

<p>ACTN2 antibody was raised in Rabbit using Human ACTN2 as the immunogen</p>

<p>Septin 9 antibody was raised using the middle region of SEPT9 corresponding to a region with amino acids VNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFAYL</p>

<p>The FTH1 antibody is a highly specialized product used in the field of Life Sciences. It is a monoclonal antibody that specifically targets the FTH1 protein, which plays a crucial role in iron metabolism and storage. This antibody is designed to detect and bind to the FTH1 protein with high specificity and sensitivity.</p>

<p>Purified Polyclonal LOK antibody</p>

<p>The ATF2 antibody is a highly specific and reliable tool for research in the field of Life Sciences. It is a polyclonal antibody that can be used to detect ATF2, a transcription factor involved in various cellular processes. This antibody has been extensively tested and validated for use in applications such as immunohistochemistry, Western blotting, and immunofluorescence.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that belongs to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. It has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.</p>

<p>FOXP3 antibody was raised in Mouse using a purified recombinant fragment of human FOXP3 expressed in E. coli as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal TCP1 epsilon antibody</p>

<p>The BAD antibody is a polyclonal antibody that specifically targets the BAD protein. BAD (Bcl-2 associated death promoter) is a key regulator of apoptosis, or programmed cell death. This antibody is widely used in life sciences research to study the role of BAD in various cellular processes.</p>

<p>TSH Alpha antibody was raised in mouse using purified human TSH alpha as the immunogen.</p>

<p>Mouse monoclonal SLFNL1 antibody</p>

<p>FBXL20 antibody was raised in rabbit using the N terminal of FBXL20 as the immunogen</p>

<p>Mouse monoclonal PIK3AP1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its exceptional bactericidal activity against tuberculosis infection. By binding to DNA-dependent RNA polymerase, this active compound inhibits bacterial growth by preventing transcription and replication. Its effectiveness has been demonstrated through patch-clamp technique experiments on human erythrocytes. Metabolized through various transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, this drug specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Rabbit polyclonal NRSN2 antibody</p>

<p>The HDAC2 antibody is a powerful tool used in life sciences research. It is commonly used to study the effects of olaparib, ferritin, and other growth factors on cellular processes. This polyclonal antibody has been extensively tested and shown to have neutralizing activity against HDAC2, an important enzyme involved in gene regulation. By blocking the activity of HDAC2, this antibody allows researchers to investigate the role of epigenetic modifications in various biological processes.</p>

<p>Rabbit polyclonal SEPARASE antibody</p>

<p>Mouse monoclonal SSX5 antibody</p>

<p>The SPTLC1 antibody is a polyclonal antibody that is used in Life Sciences research. It is commonly used to study the dipeptide substrates and disaccharides involved in sulfate synthesis. This antibody specifically targets the low-density lipoprotein receptor-related protein (LRP), which plays a crucial role in epidermal growth factor signaling. The SPTLC1 antibody has been shown to have a high affinity for LRP, making it an ideal tool for studying its function and regulation.</p>

<p>DPH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NQIPPEILKNPQLQAAIRVLPSNYNFEIPKTIWRIQQAQAKKVALQMPEG</p>

<p>MAGEB2 antibody was raised in Rabbit using Human MAGEB2 as the immunogen</p>

<p>Rabbit polyclonal VPS4B antibody</p>

<p>The USP5 antibody is a highly specific monoclonal antibody that targets the antigen α-syn (alpha-synuclein). It is designed to detect and bind to soluble α-syn in various biological samples. This antibody has been extensively validated and proven to be effective in applications such as immunohistochemistry, western blotting, and ELISA.</p>

<p>NIP7 antibody was raised in Rabbit using Human NIP7 as the immunogen</p>

<p>The VDR antibody is a powerful tool used in the field of Life Sciences. This antibody is specifically designed to target and bind to the Vitamin D Receptor (VDR), a protein involved in various cellular processes. The VDR antibody has been extensively tested and validated for its high specificity and sensitivity.</p>

<p>Purified Rabbit polyclonal USP39 antibody</p>

<p>KAP8.1 antibody was raised using the middle region of KRTAP8-1 corresponding to a region with amino acids LCDNFPGAVFPGCYWGSYGYPLGYSVGCGYGSTYSPVGYGFGYGYNGCGA</p>

<p>Purified Gram Positive Bacteria Monoclonal</p>

<p>Rabbit polyclonal B4GALT3 antibody</p>

<p>ECHS1 antibody was raised using the N terminal of ECHS1 corresponding to a region with amino acids IIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAI</p>

<p>The CD55 antibody is a glycopeptide that acts as a neuroprotective agent in the field of Life Sciences. It is a glycoprotein with specific glycan structures that play a crucial role in its function. This antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their experiments.</p>

<p>The LOXL2 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and binds to LOXL2, a protein involved in various biological processes. This antibody has been extensively studied and proven to be effective in detecting and quantifying LOXL2 levels in different samples.</p>

<p>Mouse monoclonal APC-AAT complex antibody</p>

<p>Purified Polyclonal Caspase 3 p17 antibody</p>

<p>Caldesmon antibody is a highly specific monoclonal antibody that targets caldesmon, a protein involved in smooth muscle contraction. This antibody has been widely used in various applications within the Life Sciences field. It can be used for research purposes, such as studying the expression and localization of caldesmon in different tissues and cell types. Additionally, this monoclonal antibody has neutralizing properties and can inhibit the activity of caldesmon, making it a valuable tool for investigating the functional role of this protein.</p>

<p>Mouse monoclonal PLEKHA3 antibody</p>

<p>Purified Polyclonal PIGW antibody</p>

<p>Histone H3 Monoclonal Antibody BSA/Azide Free</p>

<p>The p53 antibody is an essential tool for researchers in the field of life sciences. It is a highly specific antibody that targets the phosphatase protein p53. This protein plays a crucial role in regulating cell growth and preventing tumor formation. The p53 antibody can be used to study various cellular processes, including apoptosis, DNA repair, and cell cycle arrest.</p>

<p>PPCDC antibody was raised using the N terminal of PPCDC corresponding to a region with amino acids VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV</p>

<p>Rabbit polyclonal PSMD7 antibody</p>

<p>The CAPNS1 antibody is a monoclonal antibody that serves as an affinity ligand for adeno-associated viruses. It is specifically designed to target and bind to solubilized and isolated retinal proteins. This antibody is widely used in various life sciences research applications, such as intermediate assays and the development of new medicaments. It has demonstrated high specificity for interleukin proteins and has been proven effective in detecting autoantibodies in nuclear medicine. The CAPNS1 antibody is a valuable tool for researchers in the field of Life Sciences seeking reliable and accurate results in their experiments.</p>