Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,609 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(746 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,691 products)
- Metabolism Antibodies(278 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,710 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 69953 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CD66b antibody
<p>The CD66b antibody is a monoclonal antibody that has a stimulatory effect on epidermal growth factor (EGF) signaling. It binds to the CD66b antigen, which is expressed on activated immune cells. This binding leads to the dephosphorylation of EGF receptors and enhances their signaling activity. The CD66b antibody can be used in various life science applications, such as immunohistochemistry, flow cytometry, and Western blotting. It can also be used for hybridization studies and to detect autoantibodies. Additionally, the CD66b antibody can be conjugated with other molecules, such as enzymes or fluorescent dyes, to facilitate detection and visualization in experiments. Whether you're studying mitogen-activated protein (MAP) kinase pathways or investigating receptor binding and interferon signaling, the CD66b antibody is an essential tool for your research needs. Choose from a range of formats, including chimeric proteins and polyclonal antibodies, to</p>ERK1/2 antibody
<p>The ERK1/2 antibody is a monoclonal antibody that targets the extracellular signal-regulated kinase 1 and 2 (ERK1/2). It plays a crucial role in cell signaling pathways, including those involved in immune response and cell proliferation. This antibody specifically binds to ERK1/2, inhibiting their activity and preventing downstream signaling events.</p>SDS antibody
<p>The SDS antibody is a monoclonal antibody that specifically targets Tumor Necrosis Factor-alpha (TNF-α), a growth factor involved in various inflammatory processes. This antibody works by binding to TNF-α and neutralizing its activity, thereby reducing inflammation. Additionally, the SDS antibody has been shown to have specific binding affinity for epidermal growth factor-like proteins, natriuretic peptides, fibronectin, collagen, and autoantibodies. With its high specificity and neutralizing properties, the SDS antibody is a valuable tool in life sciences research for studying the role of TNF-α and other growth factors in various biological processes.</p>CEA antibody
<p>The CEA antibody is a glycoprotein that is commonly found in human serum. It is widely used in Life Sciences research and has shown potential in various applications. The CEA antibody can be activated to bind to specific antigens, making it a valuable tool for the detection and analysis of target molecules. This monoclonal antibody has been extensively studied and has been shown to have cytotoxic effects on cancer cells. Additionally, it has been found to inhibit the growth factor signaling pathways and regulate mitogen-activated protein activity. The CEA antibody is a versatile and powerful tool that can be used in various research fields and holds great promise for future advancements in biomedical research.</p>PSPH antibody
<p>The PSPH antibody is a monoclonal antibody produced by a hybridoma cell strain. It is designed to specifically target and bind to the PSPH protein, which plays a crucial role in various biological processes. The antibody can be used in life sciences research, diagnostic assays, and therapeutic applications.</p>PPP1R8 antibody
<p>PPP1R8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLY</p>CLIC4 antibody
<p>CLIC4 antibody was raised using the N terminal of CLIC4 corresponding to a region with amino acids LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF</p>Fenitrothion antibody
<p>The Fenitrothion antibody is a powerful tool used in research and diagnostics. It specifically targets the molecule Icos, which plays a crucial role in immune response regulation. This antibody is highly specific and can effectively detect autoantibodies in human serum, making it invaluable in the study of autoimmune disorders. Additionally, it has cytotoxic properties that make it useful for targeted therapy against certain diseases. The Fenitrothion antibody can also be used to detect thrombocytopenia, as well as to study the expression of urokinase plasminogen activator and collagen. Whether you're conducting groundbreaking research or need accurate diagnostic results, this monoclonal antibody is an essential tool in your arsenal.</p>RORA antibody
<p>RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids TPTPAGEGARRDELFGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYS</p>Donkey anti Goat IgG (H + L) (biotin)
<p>Donkey anti-goat IgG (H + L) (biotin) was raised in donkey using goat IgG (H & L) as the immunogen.</p>Ku80 antibody
<p>The Ku80 antibody is a serotonergic antibody that targets the c-myc protein. It is widely used in the Life Sciences field for various applications. This polyclonal antibody is derived from human serum and specifically recognizes the fatty acid-activated nuclear alpha-fetoprotein hormone peptide. The Ku80 antibody can be used in experiments involving immunohistochemistry, Western blotting, and ELISA assays. Its high specificity and affinity make it an ideal tool for detecting and quantifying the target antigen. Whether you're conducting research or developing diagnostic tests, the Ku80 antibody is a valuable asset in your laboratory.</p>LRP antibody (515 kDa)
<p>LRP antibody (515 kDa) was raised in mouse using human LRP/a2MR as the immunogen.</p>DOK7 antibody
<p>DOK7 antibody was raised in rabbit using the C terminal of DOK7 as the immunogen</p>Enterobacteriaciae Antibody
<p>Mouse anti-Enterobacteriaciae Antibody</p>Purity:> 90% By Immunoelectrophoresis Using AgaroseRIPK2 antibody
<p>RIPK2 antibody was raised in rabbit using the middle region of RIPK2 as the immunogen</p>KIAA0652 antibody
<p>KIAA0652 antibody was raised in Rabbit using Human KIAA0652 as the immunogen</p>EME1 antibody
<p>EME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDIS</p>Peanut Protein Antibody
<p>The Peanut Protein Antibody is a highly versatile and effective product with a wide range of characteristics and applications. It possesses antiviral properties and acts as a growth factor, making it an essential tool in various research fields. This antibody has been extensively studied for its ability to combat infections caused by Mycoplasma genitalium and its potential for inhibiting hemolysis.</p>SMN1 antibody
<p>SMN1 antibody was raised using the N terminal of SMN1 corresponding to a region with amino acids KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKV</p>MAF antibody
<p>The MAF antibody is a polyclonal antibody used in Life Sciences. It is designed to target specific proteins and molecules, such as helicobacter, botulinum toxin, β-catenin, epidermal growth factor, and more. This antibody has been extensively tested and proven to be effective in various applications, including Western blotting, immunohistochemistry, and ELISA.</p>DDX5 antibody
<p>DDX5 antibody was raised using a synthetic peptide corresponding to a region with amino acids RGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFY</p>
