Primary Antibodies

<p>Rabbit polyclonal GATA1 antibody (Ser142)</p>

<p>FGFR4 antibody was raised in Mouse using a purified recombinant fragment of FGFR4 expressed in E. coli as the immunogen.</p>

<p>The Calmodulin antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets calmodulin, a protein that plays a crucial role in various cellular processes such as growth factor signaling, regulation of enzymes like pancreatic elastase, and calcium-dependent processes in human hepatocytes. This antibody has been extensively used in research to study the function and localization of calmodulin in different cell types and tissues.</p>

<p>IKBKB antibody was raised in Mouse using a purified recombinant fragment of IKBKB expressed in E. coli as the immunogen.</p>

<p>PRSS3 antibody was raised using the N terminal of PRSS3 corresponding to a region with amino acids VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH</p>

<p>HNRPF antibody was raised using the C terminal of HNRPF corresponding to a region with amino acids LNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGCYGAGYSGQNS</p>

<p>The EpoR antibody is a life sciences product that specifically targets the erythropoietin receptor (EpoR). It is a polyclonal antibody that can be used in various applications, including research and diagnostics. The EpoR antibody binds to the EpoR protein, which is a nuclear receptor involved in erythropoiesis. By targeting this receptor, the antibody can modulate the signaling pathway and affect important biological processes such as red blood cell production.</p>

<p>F4/80 Antibody (HRP)</p>

<p>CPSF2 antibody was raised in Rabbit using Human CPSF2 as the immunogen</p>

<p>The HBP1 antibody is a polyclonal antibody that targets hepatocyte growth factor. It is used in research and diagnostic applications to detect and quantify the expression levels of HBP1. This antibody specifically binds to HBP1 and can be used for various immunoassays, including Western blotting, immunohistochemistry, and ELISA. The HBP1 antibody has been shown to have high specificity and sensitivity in detecting HBP1 in various samples. It is a valuable tool for studying the role of HBP1 in different biological processes, such as cell growth, differentiation, and development. The HBP1 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific needs. With its reliable performance and versatility, the HBP1 antibody is an essential tool for scientists working in the field of cellular biology and molecular medicine.</p>

<p>FABP4 antibody was raised in Mouse using a purified recombinant fragment of FABP4(aa61-121) expressed in E. coli as the immunogen.</p>

<p>Purified Polyclonal Tensin 1 antibody</p>

<p>Rabbit Polyclonal 4EBP1 antibody (Thr45)</p>

<p>GABRA1 antibody was raised in Rabbit using Human GABRA1 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal KLK11 antibody</p>

<p>Affinity purified Rabbit polyclonal NSUN6 antibody</p>

<p>Rabbit polyclonal PLANH1 antibody (biotin)</p>

<p>KDR antibody was raised in rabbit using the N terminal of KDR as the immunogen</p>

<p>Macrophage scavenger receptor antibody was raised in rat using Raw 264 cell line as the immunogen.</p>

<p>IFN gamma antibody (biotin) was raised in mouse using human IFN-gamma as the immunogen.</p>

<p>Rabbit polyclonal TRIM28 antibody (HRP)</p>

<p>ATIC antibody was raised using the middle region of ATIC corresponding to a region with amino acids RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT</p>

<p>CIB1 antibody was raised in Rabbit using Human CIB1 as the immunogen</p>

<p>FCRLB antibody was raised in Rabbit using Human FCRLB as the immunogen</p>

<p>Protein S antibody (HRP) was raised in goat using human Protein S purified from plasma as the immunogen.</p>

<p>RHOB antibody was raised using the middle region of RHOB corresponding to a region with amino acids CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDY</p>

<p>Donkey anti-mouse IgG (H + L) (rhodamine) was raised in donkey using murine IgG (H&amp;L) as the immunogen.</p>

<p>CTSS antibody was raised in rabbit using the N terminal of CTSS as the immunogen</p>

<p>Rabbit polyclonal CNKR1 antibody</p>

<p>Purified Polyclonal PIK3R6 antibody</p>

<p>Rabbit Polyclonal Paxillin antibody (Tyr118)</p>

<p>FBLIM1 antibody was raised in Rabbit using Human FBLIM1 as the immunogen</p>

<p>NET1 antibody was raised using the N terminal of NET1 corresponding to a region with amino acids RGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDITMKESLTTREIRR</p>

<p>KCNN1 antibody was raised using the C terminal of KCNN1 corresponding to a region with amino acids KIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQHEELEARLATLESRLD</p>

<p>The hnRNPF antibody is a polyclonal antibody that is used in various diagnostic applications. It is highly reactive and can be used to detect the presence of hnRNPF, a serine protease, in biological samples. This antibody has neutralizing properties and can be used to inhibit the activity of hnRNPF in experimental settings. It is commonly used as a diagnostic reagent in research laboratories and clinical settings.</p>

<p>The cSRC antibody is a highly specialized Polyclonal Antibody used in Life Sciences research. This antibody specifically targets the activated form of the cSRC protein, which plays a crucial role in cell signaling and regulation.</p>

<p>Purified Polyclonal RPL27A antibody</p>

<p>CDC45L antibody was raised in Rabbit using Human CDC45L as the immunogen</p>

<p>GDE1 antibody was raised in Rabbit using Human GDE1 as the immunogen</p>

<p>Rabbit polyclonal Kv2.1 antibody (Ser805)</p>

<p>ARHGAP15 antibody was raised using the middle region of ARHGAP15 corresponding to a region with amino acids VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ</p>

<p>Rabbit polyclonal NRIP2 antibody</p>

<p>Rabbit polyclonal Adiponectin antibody (biotin)</p>

<p>Purified Polyclonal SURF1 antibody</p>

<p>Rabbit polyclonal PNPLA6 antibody</p>

<p>PCI antibody was raised in goat using human Protein C Inhibitor purified from plasma as the immunogen.</p>

<p>AGXT2L2 antibody was raised in Rabbit using Human AGXT2L2 as the immunogen</p>

<p>The Contactin 2 antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that specifically targets Contactin 2, a protein involved in cell adhesion and neuronal development. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including autoimmune disorders and cancer.</p>

<p>CD9 antibody was raised in mouse using human CD9 as the immunogen.</p>

<p>Rabbit polyclonal CCKAR antibody</p>