Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,609 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(746 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,392 products)
- Metabolism Antibodies(278 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,710 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75081 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
RIPK5 antibody
<p>RIPK5 antibody was raised using the middle region of RIPK5 corresponding to a region with amino acids EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS</p>RABEPK antibody
<p>RABEPK antibody was raised using the N terminal of RABEPK corresponding to a region with amino acids MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKV</p>HAX1 antibody
HAX1 antibody was raised using the middle region of HAX1 corresponding to a region with amino acids LPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQPHNRNPC antibody
<p>HNRNPC antibody was raised using a synthetic peptide corresponding to a region with amino acids ESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSAN</p>NGAL antibody
<p>The NGAL antibody is a highly specialized monoclonal antibody that has been extensively studied in the field of Life Sciences. It is an 8-substituted antibody that exhibits glycosylation, making it highly effective in targeting specific molecules and proteins within the body. The NGAL antibody has shown promising results in inhibiting interleukin-6, a key growth factor involved in various inflammatory processes. Additionally, this antibody has demonstrated its efficacy in neutralizing antibodies such as erythropoietin and epidermal growth factor, which play crucial roles in certain diseases. The NGAL antibody's unique structure allows it to bind specifically to tyrosine residues on target molecules, enabling precise targeting and modulation of cellular functions. Its binding affinity has been proven through rigorous laboratory testing using state-of-the-art electrode techniques. In recent studies, the NGAL antibody has shown potential therapeutic effects against Helicobacter pylori infection, a bacteria known for causing gastric ulcers and other gastrointestinal disorders. Furthermore, this</p>CDKL5 antibody
<p>The CDKL5 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the CDKL5 protein, which plays a crucial role in various cellular processes. The antibody works by binding to the CDKL5 protein and inhibiting its activity, allowing researchers to study its function and potential therapeutic applications.</p>PGAM1 antibody
<p>The PGAM1 antibody is a highly versatile and potent tool used in various industries, including Life Sciences and industrial applications. This antibody exhibits antioxidant activity and has been shown to have an inhibitory effect on the growth factor. It can be immobilized for use in various assays, making it an essential component in molecular biology research.</p>USP5 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in</p>GAPDH antibody
<p>The GAPDH antibody is a highly effective polyclonal antibody that is capable of neutralizing the activity of glyceraldehyde-3-phosphate dehydrogenase (GAPDH). This antibody has been extensively tested and shown to effectively inhibit the function of GAPDH in various experimental settings.</p>ADH6 antibody
<p>ADH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID</p>TS antibody
<p>The TS antibody is an autoantibody that specifically targets glial fibrillary acidic protein (GFAP), a protein found in the central nervous system. It is commonly used in life sciences research to study the role of GFAP in various cellular processes. The TS antibody recognizes specific epitopes on GFAP and can be used for immunohistochemistry, immunocytochemistry, and Western blotting applications. This monoclonal antibody has high specificity and sensitivity, making it a valuable tool for studying GFAP expression and function. Additionally, the TS antibody can be conjugated with different fluorophores or enzymes for multiplexing experiments or detection purposes. Whether you're researching neurodegenerative diseases or investigating cellular responses to growth factors, the TS antibody is an essential reagent for your experiments. Trust its reliability and performance to deliver accurate and reproducible results in your scientific endeavors.</p>IFN gamma antibody
<p>The IFN gamma antibody is a monoclonal antibody that targets interferon gamma, a cytokine involved in immune response regulation. This antibody specifically binds to interferon gamma and neutralizes its activity, making it an effective tool for research in the field of immunology. The IFN gamma antibody has been widely used in various life science applications, including ELISA, Western blotting, flow cytometry, and immunohistochemistry. It can be conjugated with different labels such as biotin or fluorescent dyes for detection purposes. Researchers rely on this antibody to study the role of interferon gamma in various diseases and to develop potential therapeutic strategies targeting this cytokine.</p>NCOA3 antibody
<p>NCOA3 antibody was raised in Mouse using a purified recombinant fragment of NCOA3(aa1-200) expressed in E. coli as the immunogen.</p>MIP antibody
<p>The MIP antibody is a monoclonal antibody that specifically targets insulin. It belongs to the group of inhibitors used in Life Sciences research. This antibody can be used in various applications, such as immunohistochemistry, Western blotting, and ELISA assays. The MIP antibody binds to insulin with high affinity and specificity, making it an essential tool for studying insulin-related processes and diseases.</p>SMARCD1 antibody
<p>SMARCD1 antibody was raised using the middle region of Smarcd1 corresponding to a region with amino acids RKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQ</p>PURB antibody
<p>PURB antibody was raised using the N terminal of PURB corresponding to a region with amino acids MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDV</p>GOT1 antibody
<p>GOT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV</p>ITGB1BP2 antibody
<p>ITGB1BP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDF</p>Prothrombin factor II antibody (HRP)
<p>Prothrombin factor II antibody (HRP) was raised in sheep using human Prothrombin purified from plasma as the immunogen.</p>HMOX2 antibody
<p>HMOX2 antibody was raised in rabbit using the N terminal of HMOX2 as the immunogen</p>
