Primary Antibodies

<p>P2RX2 antibody was raised using the middle region of P2RX2 corresponding to a region with amino acids LIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEK</p>

Rabbit polyclonal NDKA antibody (biotin)

<p>CACNB2 antibody was raised using the middle region of CACNB2 corresponding to a region with amino acids DACEHLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQG</p>

<p>Rabbit polyclonal RGS13 antibody</p>

<p>The TSPAN33 antibody is a highly specialized product used in Life Sciences research. It is an antibody that specifically targets the glycan region of brain natriuretic peptide (BNP). By neutralizing BNP, this antibody can be used to study the role of BNP in various physiological and pathological processes.</p>

<p>The BDNF antibody is a neuroprotective agent that acts as a family kinase inhibitor. It targets the adiponectin receptor, which is involved in various cellular processes related to adipose tissue. This antibody is commonly used in life sciences research and is available as both polyclonal and monoclonal antibodies.</p>

<p>Rabbit polyclonal STAT3 antibody (Ser727)</p>

Mouse monoclonal POLR2J2 antibody

DTX2 antibody was raised in Rabbit using Human DTX2 as the immunogen

<p>Affinity purified Rabbit polyclonal VATPase a4 antibody</p>

<p>CRNN antibody was raised in Rabbit using Human CRNN as the immunogen</p>

<p>CXADR antibody was raised in Rabbit using Human CXADR as the immunogen</p>

<p>Rabbit polyclonal CEBPG antibody</p>

<p>Rabbit polyclonal PMPCB antibody</p>

<p>Akt, also known as Protein Kinase B (PKB), is a critical signaling protein in cells that regulates essential processes like cell growth, survival, metabolism, and proliferation. It functions within the PI3K/Akt pathway, one of the primary pathways for cell survival and growth, which is activated by growth factors and hormones such as insulin. Upon activation, Akt is recruited to the cell membrane, where it is phosphorylated by kinases like PDK1, triggering its full activation. This allows Akt to influence downstream processes, promoting cell survival by inhibiting apoptosis, supporting cell growth via pathways like mTOR, and enhancing glucose metabolism—especially important for insulin response.Akt plays a significant role in diseases like cancer and diabetes. Dysregulation of the Akt pathway is frequently observed in cancer, often due to mutations in pathway components such as PI3K, PTEN, or Akt itself, resulting in increased cell survival, growth, and resistance to therapies. In diabetes, insulin resistance diminishes Akt pathway responsiveness, reducing glucose uptake and leading to elevated blood glucose levels. Thus, the Akt pathway is a focal point in therapeutic research, particularly for diseases where its regulatory effects on cell growth and metabolism are implicated.</p>

<p>C6ORF154 antibody was raised using the middle region of C6Orf154 corresponding to a region with amino acids NLDYNPLGDHVAGMLAVAVASSRTLEVLDLEGTGLTNQSAQTLLDMVENY</p>

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. The efficacy of this drug has been demonstrated through patch-clamp technique studies on human erythrocytes.

<p>GM2A antibody was raised using the N terminal of GM2A corresponding to a region with amino acids MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRS</p>

<p>C1ORF190 antibody was raised using the middle region of C1Orf190 corresponding to a region with amino acids SIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRL</p>

FSH antibody was raised in mouse using high purity intact FSH from human pituitary gland as the immunogen.

Mouse monoclonal RNPEP antibody

<p>Mouse monoclonal RNF113B antibody</p>

<p>The EIF4E antibody is a growth factor that plays a crucial role in cellular processes related to telomerase and protein synthesis. This antibody, widely used in Life Sciences research, specifically targets EIF4E dimers in order to inhibit its activity. By blocking the function of EIF4E, this antibody prevents the translation initiation process necessary for protein synthesis.</p>

<p>NSUN6 antibody was raised using the N terminal of NSUN6 corresponding to a region with amino acids SIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPS</p>

<p>The SAMHD1 antibody is a highly specialized tool used in various assays and research applications. It specifically targets SAMHD1, an EGF-like glycoprotein involved in cellular processes. This antibody is designed to inhibit the activity of SAMHD1 and can be used as a valuable tool for studying its function.</p>

<p>Rat monoclonal CD150 antibody (FITC)</p>

<p>Rabbit polyclonal MTR1A antibody</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>Purified Polyclonal SHCB antibody</p>

Mouse monoclonal anti human FCGR1A antibody

<p>Affinity purified Rabbit polyclonal CKLFSF5 antibody</p>

<p>HTR2A antibody was raised in rabbit using the N terminal of HTR2A as the immunogen</p>

<p>Purified Polyclonal TCF7 antibody</p>

ATP5H antibody was raised in Rabbit using Human ATP5H as the immunogen

<p>Chicken RBC antibody (FITC) was raised in rabbit using chicken erythrocytes as the immunogen.</p>

<p>Purified Polyclonal NDUFA4 antibody</p>

<p>Rabbit polyclonal KPB1/2 antibody</p>

<p>The GCG antibody is a monoclonal antibody that specifically targets the CD20 protein, a glycoprotein found on the surface of certain cells. This antibody-drug complex is designed to bind to the CD20 antigen, leading to the inhibition of cell growth and proliferation. The GCG antibody has shown promising results in the treatment of various diseases, including certain types of cancer and autoimmune disorders. It works by selectively targeting and destroying CD20-positive cells while sparing healthy cells. In addition to its therapeutic applications, this monoclonal antibody can also be used as a research tool for studying the role of CD20 in various biological processes. Its high specificity and affinity make it an invaluable tool for scientists and researchers working in the field of immunology.</p>

<p>KIAA0892 antibody was raised using the middle region of KIAA0892 corresponding to a region with amino acids MHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQNGPNTSLASLL</p>

<p>The ErbB2 antibody is a highly effective and versatile product that offers a wide range of benefits. It contains sorafenib, an n-oxide compound that has been proven to inhibit the growth of cancer cells. Additionally, this antibody can be used in combination with other drugs such as doxorubicin to enhance their effectiveness.</p>

<p>Rabbit polyclonal UBE2K antibody</p>

<p>CD49d antibody was raised in rat using the alpha-4 chain of the VLA-4 integrin heterodimer as the immunogen.</p>

<p>The PPARD antibody is a neutralizing antibody that belongs to the class of low-molecular-weight antibodies in the field of Life Sciences. It is a polyclonal antibody that specifically targets and inhibits the activity of PPARD, which is a growth factor receptor involved in various cellular processes. This antibody can be used as a therapeutic agent or research tool to study the role of PPARD in different biological systems. The PPARD antibody can be detected using techniques such as Western blotting or immunohistochemistry, and it can be conjugated to streptavidin or other molecules for specific applications. This antibody holds great potential for the development of novel medicaments and therapies targeting PPARD signaling pathways.</p>

<p>KLC3 antibody was raised using the middle region of KLC3 corresponding to a region with amino acids MLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL</p>

<p>The PKR1 antibody is a highly specialized chemokine that is activated in various Life Sciences applications. This antibody has been extensively studied and proven to be effective in targeting fatty acids and growth factors. It is a monoclonal antibody that specifically targets the PKR1 receptor, which plays a crucial role in cell signaling pathways. The PKR1 antibody has shown remarkable results in inhibiting the growth of cancer cells, including MCF-7 breast cancer cells, by blocking the epidermal growth factor receptor pathway. Additionally, it has been used as an anti-CD33 antibody to target leukemia cells and as a mesenchymal stem cell inhibitor for research purposes. With its potent activity and specificity, the PKR1 antibody is a valuable tool for researchers working in the field of molecular biology and drug discovery.</p>

<p>NUDT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids SPKFNEKDGHVERKSKNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHA</p>

beta NGF antibody was raised in mouse using highly pure recombinant human beta-NGF as the immunogen.

<p>Rabbit polyclonal ZNF774 antibody</p>

<p>KCTD4 antibody was raised using the middle region of KCTD4 corresponding to a region with amino acids RSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIQFKYFI</p>

<p>USF2 antibody was raised in mouse using recombinant H.Sapiens Usf2 Gene</p>