Primary Antibodies

<p>CAMLG antibody was raised using the N terminal of CAMLG corresponding to a region with amino acids LLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRV</p>

<p>Rabbit polyclonal ARRD4 antibody</p>

Rabbit polyclonal REPS2 antibody

<p>Mouse monoclonal ANAPC2 antibody</p>

TDRD9 antibody was raised using the middle region of TDRD9 corresponding to a region with amino acids AINIRDVLIQQGYAELTEESYESKQSHEVLKGLFSKSVENMTDGSVPFPM

<p>CD8a antibody was raised in rat using murine thymus or spleen as the immunogen.</p>

<p>EPHB6 antibody was raised in Mouse using a purified recombinant fragment of EPHB6 expressed in E. coli as the immunogen.</p>

<p>ICAM2 antibody is a growth factor that plays a crucial role in various cellular processes. It has been shown to be involved in the regulation of immune responses, cell adhesion, and signal transduction. This antibody specifically targets ICAM2, an antigen expressed on the surface of cells.</p>

<p>Rabbit polyclonal PEK antibody (Thr981)</p>

<p>TNNI3K antibody was raised using the middle region of TNNI3K corresponding to a region with amino acids PGRSHVAALRSRFELEYALNARSYAALSQSAGQYSSQGLSLEEMKRSLQY</p>

<p>C5ORF36 antibody was raised using the N terminal Of C5Orf36 corresponding to a region with amino acids CFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWD</p>

<p>Sheep RBC antibody (FITC) was raised in rabbit using ovine erythrocytes as the immunogen.</p>

The BRDU antibody is a growth factor that belongs to the class of glycoproteins. It acts by binding to specific proteins and promoting cell growth and division. This monoclonal antibody is highly specific and targets activated cells, making it a valuable tool in cancer research and diagnostics. The BRDU antibody can be used in various applications, including immunohistochemistry, flow cytometry, and western blotting. It is also cytotoxic, meaning it can selectively kill cells expressing the target protein. Additionally, this antibody has shown potential as an inhibitor of transmembrane conductance and has been implicated in the regulation of autoantibodies and chemokines. With its high specificity and versatility, the BRDU antibody is an essential tool for researchers studying cell growth and signaling pathways.

The AFP antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP), a growth factor found in adipose tissue. This antibody is widely used in life sciences research and has various applications in the field. It can be used as an inhibitor to study the function of AFP or as a tool to detect and measure AFP levels in biological samples.

<p>The CR4 antibody is a highly specialized monoclonal antibody that targets cholinergic growth factors, specifically choline acetyltransferase. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>OR2B2 antibody was raised in rabbit using the C terminal of OR2B2 as the immunogen</p>

<p>LRRC37B antibody was raised using the N terminal of LRRC37B corresponding to a region with amino acids VSRPTKFVVSPKNLKKDLAERWSLPEIVGIPHQLSKPQRQKQTLPDDYLS</p>

<p>Mouse monoclonal TTLL12 antibody</p>

<p>Rabbit polyclonal GRIN2C antibody (Ser1096)</p>

<p>Rabbit polyclonal DLGAP5 antibody</p>

<p>Rabbit polyclonal PECR antibody</p>

<p>Rabbit polyclonal ATF2 antibody (Ser480)</p>

The HBsAg antibody is a monoclonal antibody that specifically targets the alpha-fetoprotein (AFP) in human serum. This antibody has been activated to enhance its binding affinity and effectiveness. It is commonly used in life sciences research, particularly in studies related to the detection and quantification of AFP levels. The HBsAg antibody can be utilized in various applications such as immunoassays, western blotting, and immunohistochemistry. Its high specificity ensures accurate and reliable results. Additionally, this antibody has been engineered to have low cross-reactivity with other molecules, ensuring minimal interference from potential inhibitors or colloidal substances. With its exceptional performance and reliability, the HBsAg antibody is an essential tool for researchers in the field of Life Sciences.

HERC6 antibody was raised using the N terminal of HERC6 corresponding to a region with amino acids LSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAH

<p>Purified Polyclonal DGK beta antibody</p>

<p>Rabbit polyclonal RAB43 antibody</p>

<p>Rabbit polyclonal DDX39B antibody (FITC)</p>

<p>Rabbit polyclonal NFKB1 antibody (FITC)</p>

<p>The PON1 antibody is a monoclonal antibody that has the ability to neutralize the activity of paraoxonase 1 (PON1). PON1 is an enzyme that plays a crucial role in protecting against oxidative stress and inflammation. By binding to PON1, this antibody can inhibit its activity and prevent the harmful effects associated with oxidative stress.</p>

<p>The p63 antibody is a highly specialized antibody used in the field of Life Sciences. It is a nuclear antibody that reacts specifically with p63 protein, an essential regulator of cell growth and development. This polyclonal antibody is designed to recognize and bind to the activated form of p63 in various biological samples.</p>

<p>Purified Polyclonal ST3N antibody</p>

<p>Rabbit polyclonal EGF antibody (FITC)</p>

KMO antibody was raised in Rabbit using Human KMO as the immunogen

<p>The HPX antibody is a neutralizing antibody that targets interferon and autoantibodies. It has been shown to have a high affinity for hemoglobin and growth factors. This polyclonal antibody is capable of binding to various proteins, including alpha-fetoprotein, c-myc, telomerase, collagen, and fibronectin. The HPX antibody can form complexes with these proteins, leading to their neutralization and inhibition of their biological activities. This antibody is widely used in research and diagnostic applications for its ability to detect and quantify specific proteins in various samples. Its versatility and specificity make it an essential tool for studying protein-protein interactions and understanding the role of specific proteins in various biological processes.</p>

<p>DOC2B antibody was raised in Rabbit using Human DOC2B as the immunogen</p>

<p>Arntl2 antibody was raised in rabbit using the C terminal of Arntl2 as the immunogen</p>

<p>The RARG antibody is a monoclonal antibody that targets the retinoic acid receptor gamma (RARG). It acts as a growth factor and has been shown to inhibit hepatocyte growth. This antibody can be used for various applications, including research and therapeutic purposes. It has been found to have cytotoxic effects on cancer cells, such as MCF-7, and can also enhance the efficacy of other anticancer drugs. The RARG antibody binds specifically to RARG and modulates its activity, affecting downstream signaling pathways involved in cell proliferation, differentiation, and apoptosis. It has also been shown to interact with other proteins, such as fibronectin and lipoprotein lipase. This versatile antibody is a valuable tool for studying the role of RARG in various biological processes and may have potential applications in cancer treatment.</p>

<p>The CYB5R3 antibody is a polyclonal antibody that plays a crucial role in various cholinergic and growth factor-related processes in Life Sciences. It is commonly used in research to study the cytotoxic effects of certain compounds on liver microsomes and dopamine metabolism. The CYB5R3 antibody specifically targets and binds to activated CYB5R3, an enzyme involved in electron transfer reactions. This binding inhibits the enzymatic activity of CYB5R3, leading to a decrease in the production of reactive oxygen species and neuroprotective effects. Additionally, this antibody has been shown to inhibit the expression of interleukin-6, a pro-inflammatory cytokine. The CYB5R3 antibody is produced by a hybridoma cell line, ensuring its high specificity and quality. Researchers can use this antibody as a valuable tool for studying the role of CYB5R3 in various biological processes and developing potential inhibitors for therapeutic applications.</p>

<p>Rabbit polyclonal PSMB2 antibody</p>

<p>Mouse monoclonal COBRA1 antibody</p>

<p>ITPK1 antibody was raised using the N terminal of ITPK1 corresponding to a region with amino acids MEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYI</p>

The Ractopamine antibody is a specific monoclonal antibody that has been developed for research purposes in the field of Life Sciences. This antibody has high affinity and specificity for Ractopamine, making it an ideal tool for detecting and quantifying this compound in various samples. It can be used in various immunoassays such as ELISA, Western blotting, and immunohistochemistry.

<p>Rabbit polyclonal TLP1 antibody</p>

<p>NEK7 antibody was raised using a synthetic peptide corresponding to a region with amino acids KARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMI</p>

<p>The IRS1 antibody is a monoclonal antibody that specifically targets insulin receptor substrate 1 (IRS1). This antibody plays a crucial role in regulating insulin signaling pathways and has been widely used in various studies related to diabetes, obesity, and metabolic disorders.</p>

<p>The P21 antibody is a highly specialized polyclonal antibody that is used in various fields of life sciences. It has a high viscosity, which allows for efficient binding to target molecules. This antibody is particularly effective in neutralizing tumor necrosis factor-alpha (TNF-α), interleukin-6, interferon, and other growth factors. Its monoclonal nature ensures a specific antigen-antibody reaction, making it suitable for various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assays (ELISA). Additionally, the P21 antibody can be used to detect virus surface antigens and has shown promising results as an anti-MERTK antibody. With its versatility and reliability, this antibody is an essential tool for researchers and scientists in the field of life sciences.</p>

Purified Rabbit polyclonal p70S6K antibody (Ser418)

<p>LYSMD2 antibody was raised using the middle region of LYSMD2 corresponding to a region with amino acids VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE</p>

Mouse monoclonal TBXAS1 antibody

The Cyclin A antibody is a highly specialized and potent phosphatase inhibitor that is widely used in industrial applications. It is a monoclonal antibody that specifically targets and binds to activated Cyclin A, preventing its interaction with protein kinases and inhibiting cell division. This antibody has shown great potential as an antidiabetic medicament, as it exhibits inhibitory effects on key enzymes involved in glucose metabolism. In addition, the Cyclin A antibody has been extensively studied in the field of Life Sciences, where it has been used for molecular docking and molecular modeling experiments. Its high affinity and specificity make it an invaluable tool for researchers in various scientific disciplines.