Primary Antibodies

<p>The Influenza B antibody is a highly specialized antibody that targets the influenza B virus. It works by neutralizing the virus surface antigen, preventing it from infecting healthy cells. This antibody is classified as a monoclonal antibody, meaning it is produced from a single clone of immune cells. It has been shown to have cytotoxic effects on infected cells and can also activate immune responses such as the production of interleukin-6 and interferon-gamma.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug effectively inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive studies have shown its high efficacy in human activity using a patch-clamp technique on human erythrocytes.</p>

<p>CAMK2D antibody was raised in Rabbit using Human CAMK2D as the immunogen</p>

Mouse monoclonal CBWD1 antibody

<p>FZR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN</p>

Prekallikrein antibody (HRP) was raised in sheep using human active site-blocked Kallikrein prepared from plasma as the immunogen.

Mouse monoclonal CP15 antibody

<p>Purified Polyclonal ANAPC1 antibody</p>

ICAM1 antibody was raised in Mouse using a purified recombinant fragment of human ICAM1(28-480aa) expressed in E. coli as the immunogen.

The CD56 antibody is a monoclonal antibody that specifically targets CD56, a cell adhesion molecule found on the surface of various cell types. It is used in Life Sciences research and diagnostics to detect and analyze CD56 expression. This antibody has also been shown to have potential therapeutic applications, particularly in the treatment of certain cancers.

<p>DDI1 antibody was raised in Rabbit using Human DDI1 as the immunogen</p>

<p>Rabbit polyclonal cJun antibody (Thr93)</p>

<p>Rabbit Polyclonal ADAM2 antibody</p>

<p>TRPC6 antibody was raised using the middle region of TRPC6 corresponding to a region with amino acids KKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSE</p>

<p>The S6K1 antibody is a powerful tool for researchers in the field of life sciences. It is an antibody that specifically targets and inhibits the activity of S6K1, a protein kinase that plays a crucial role in various cellular processes. This polyclonal antibody has been extensively validated and proven to be highly specific and effective in blocking the activation of S6K1.</p>

<p>The VEGFD antibody is a highly specialized antibody that targets Vascular Endothelial Growth Factor D (VEGFD). This antibody has been extensively studied and has shown great potential in various fields, particularly in the Life Sciences.</p>

<p>MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREI</p>

<p>ARPC5 antibody was raised in Rabbit using Human ARPC5 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal HRPAP20 antibody</p>

<p>Purified Polyclonal IKK gamma antibody</p>

<p>Rabbit polyclonal IKK gamma antibody (Ser376)</p>

<p>Purified Polyclonal NEFL antibody</p>

<p>The CD18 antibody is a highly specialized Polyclonal Antibody used in Life Sciences research. It is known for its antiangiogenic properties and its ability to neutralize endothelial growth factors, chemokines, and other growth factors involved in cell proliferation. This antibody has been extensively studied and proven effective in various research applications.</p>

<p>Rabbit polyclonal GLI3 antibody</p>

Rat monoclonal PD1 antibody (PE)

<p>DPPA4 antibody was raised using the N terminal of DPPA4 corresponding to a region with amino acids MLRGSASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTK</p>

<p>Rabbit polyclonal KOR1 antibody</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>RTN3 antibody was raised in Mouse using a purified recombinant fragment of RTN3 expressed in E. coli as the immunogen.</p>

<p>POFUT2 antibody was raised using the C terminal of POFUT2 corresponding to a region with amino acids RFEPTWEELELYKDGGVAIIDQWICAHARCLPTSLSAESGSGGFQRFFCP</p>

<p>LARP6 antibody was raised using the middle region of LARP6 corresponding to a region with amino acids MGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRAC</p>

<p>Rabbit polyclonal PPP1R14A antibody</p>

<p>The Tyrosine Hydroxylase antibody is a specific antibody used in Life Sciences research. It is commonly used to study the cholinergic and dopamine systems in the brain. This antibody targets tyrosine hydroxylase, which is an enzyme involved in the synthesis of dopamine. By detecting and measuring levels of tyrosine hydroxylase, researchers can gain valuable insights into neurological disorders such as Parkinson's disease and schizophrenia.</p>

<p>PDHA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIYS</p>

<p>Mouse monoclonal IkBa antibody (N-terminus)</p>

<p>Mouse monoclonal CYB5R1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to target tuberculosis infection and contains active compounds that exhibit strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has been conducted using a patch-clamp technique on human erythrocytes, confirming its high efficacy in humans. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.</p>

<p>CCND3 antibody was raised in Rabbit using Human CCND3 as the immunogen</p>

<p>Rabbit polyclonal Chicken Serum Albumin antibody (HRP)</p>

<p>GRIN1 antibody was raised in Rabbit using Human GRIN1 as the immunogen</p>

The NUMB antibody is a monoclonal antibody derived from streptomyces. It has hypomethylating properties and is used in the field of life sciences for various applications. This antibody specifically targets and binds to NUMB, a protein involved in cell differentiation and development. The NUMB antibody has chemotherapeutic potential and has been studied for its ability to inhibit the growth of cancer cells. It can also be used in research settings for chromatographic and immunohistochemical studies. With its unique properties and specificity, the NUMB antibody offers promising avenues for further exploration in the field of molecular biology and therapeutics.

<p>Rabbit polyclonal CCL2 antibody (biotin)</p>

<p>The SIRT1 antibody is a highly specialized antibody used in the field of Life Sciences. It specifically targets and binds to the SIRT1 protein, which is involved in various cellular processes such as epidermal growth factor signaling and histone deacetylation. This monoclonal antibody offers high specificity and sensitivity, making it an ideal tool for researchers studying the role of SIRT1 in different biological pathways.</p>

CRSP2 antibody was raised in mouse using recombinant Human Cofactor Required For Sp1 Transcriptional Activation, Subunit 2, 150Kda (Crsp2)

<p>The NUP62 antibody is a polyclonal antibody that specifically binds to NUP62, a protein involved in various cellular processes. This antibody can be used in life sciences research to study the role of NUP62 in different biological pathways. It has been shown to interact with other binding proteins and lipoprotein lipase, suggesting its involvement in lipid metabolism. Additionally, the NUP62 antibody has the ability to bind to cations and growth factors, indicating its potential role in signal transduction pathways. This antibody can also be used for the detection of autoantibodies in reactive conditions or as a diagnostic tool for diseases such as cancer. The NUP62 antibody is produced using advanced techniques and high-quality materials, ensuring reliable and reproducible results.</p>

<p>DR1 antibody was raised in Rabbit using Human DR1 as the immunogen</p>

<p>C19ORF54 antibody was raised using the N terminal Of C19Orf54 corresponding to a region with amino acids MTSPCSPPLKPPISPPKTPVPQASSIPSPPLPPSPLDFSALPSPPWSQQT</p>

<p>KCNH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LTNSRSVLQQLTPMNKTEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPH</p>

<p>Junctophilin 1 antibody was raised using the C terminal of JPH1 corresponding to a region with amino acids KESKAEPKAKKSELAIPKNPASNDSCPALEKEANSGPNSIMIVLVMLLNI</p>

The PRDX1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to PRDX1, a protein involved in various cellular processes. This antibody has been shown to inhibit collagen production and the activity of certain enzymes, making it a potential therapeutic option for conditions related to collagen disorders and enzyme dysregulation. Additionally, the PRDX1 antibody has cytotoxic properties, meaning it can induce cell death in specific cell types. It can also be used as a tool in laboratory experiments to detect and quantify PRDX1 levels in samples. With its ability to target PRDX1 and modulate its function, this antibody holds promise for developing novel treatments and understanding the role of PRDX1 in different biological pathways.