Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,624 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75324 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
FYN antibody
<p>The FYN antibody is a powerful tool in the field of Life Sciences. It specifically targets the amino-terminal region of proteins, making it ideal for research involving TNF-α and other glycosylated molecules. This antibody is designed to neutralize the activity of these proteins, allowing researchers to study their functions and interactions in detail.</p>BLNK antibody
<p>The BLNK antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is an inhibitor of 6-phosphogluconate dehydrogenase and methyl transferase, making it an essential component in the development of new medicines and inhibitors. The BLNK antibody is a monoclonal antibody that specifically targets and binds to the HDAC enzyme, which is responsible for regulating gene expression through histone acetylation. This binding process leads to the inhibition of HDAC activity, resulting in altered gene expression patterns.</p>Carboxylesterase 2 antibody
<p>Carboxylesterase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERH</p>MCEE antibody
<p>MCEE antibody was raised in rabbit using the C terminal of MCEE as the immunogen</p>ApoO antibody
<p>ApoO antibody was raised in Mouse using a purified recombinant fragment of ApoO expressed in E. coli as the immunogen.</p>IBA antibody
<p>The IBA antibody is a highly effective and versatile product used in the field of Life Sciences. This colloidal, neutralizing antibody has been extensively tested and proven to be effective in various applications. It has shown excellent results in liver microsomes, where it acts as a potent inhibitor of multidrug resistance-associated protein (MRP) and chemokine receptors.</p>Ornithine decarboxylase antibody (HRP)
<p>Rabbit polyclonal Ornithine decarboxylase antibody (HRP)</p>MAPK10 antibody
MAPK10 antibody was raised in Mouse using a purified recombinant fragment of human MAPK10 (aa28-233) expressed in E. coli as the immunogen.A1CF antibody
<p>A1CF antibody was raised using the N terminal of A1CF corresponding to a region with amino acids MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAA</p>ITGA5 antibody
<p>The ITGA5 antibody is a powerful tool in the field of Life Sciences. It specifically targets and binds to the integrin alpha 5 (ITGA5) protein, which plays a crucial role in various cellular processes. This antibody can be used for research purposes, such as studying the interaction between ITGA5 and other molecules like TGF-beta or collagen. It is available both as a polyclonal antibody and a monoclonal antibody, offering researchers different options based on their specific needs.</p>CD24 antibody (Azide Free)
<p>CD24 antibody (Azide Free) was raised in rat using murine heat stable antigen as the immunogen.</p>TRANCE antibody
The TRANCE antibody is an inhibiting antibody that targets pluripotent stem cells. It acts as an inhibitor by binding to specific receptors on the surface of these stem cells, preventing their growth and differentiation. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.UBA5 antibody
<p>The UBA5 antibody is a highly specialized protein kinase and phosphatase that plays a crucial role in various Life Sciences applications. It is widely used in research laboratories for its ability to detect and quantify specific proteins and biomolecules. This antibody has been extensively studied and proven to be effective in detecting targets such as alpha-fetoprotein, genotoxic inhibitors, anti-beta amyloid antibodies, chemokines, and growth factors.</p>
