Primary Antibodies

<p>Annexin A7 antibody was raised using the N terminal of ANXA7 corresponding to a region with amino acids GGQMPSQYPGGQPTYPSQPATVTQVTQGTIRPAANFDAIRDAEILRKAMK</p>

<p>The GST Antibody is a highly specific and potent antibody that targets the cytosolic protein GST. It is designed to recognize and bind to the target molecule with high affinity, making it an ideal tool for various applications in Life Sciences research. The antibody is produced using advanced techniques, including DNA aptamer technology, resulting in a highly purified and effective product.</p>

KCNAB3 antibody was raised using the N terminal of KCNAB3 corresponding to a region with amino acids RNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEV

<p>NR2C2 antibody was raised using the C terminal of NR2C2 corresponding to a region with amino acids AQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNS</p>

<p>ARL3 antibody was raised in rabbit using the N terminal of ARL3 as the immunogen</p>

<p>The Villin antibody is a highly effective and versatile tool in the field of biomedical research. This colloidal antibody specifically targets β-catenin, a key regulator of cell growth and development. By neutralizing β-catenin activity, this monoclonal antibody can inhibit the signaling pathways associated with epidermal growth factor (EGF) and interleukins, which play crucial roles in cellular processes such as proliferation and differentiation.</p>

<p>The SDHB antibody is a highly effective neutralizing monoclonal antibody that targets a specific growth factor. It is colloidal in nature and has been extensively studied for its therapeutic potential. This antibody binds to a specific antigen, preventing it from interacting with its receptor and inhibiting the downstream signaling pathway. The SDHB antibody has also been shown to have neurotrophic and neuroprotective effects, making it a promising candidate for the treatment of neurological disorders. Additionally, this antibody has been used in research settings to detect the presence of certain proteins, such as the circumsporozoite protein. Its high specificity and sensitivity make it a valuable tool for various applications in both academic and industrial settings.</p>

<p>Affinity purified Rabbit polyclonal STRA8 antibody</p>

Rabbit polyclonal BAI2 antibody

<p>Mouse monoclonal ITLN1 antibody</p>

<p>hCG_2042202 antibody was raised in rabbit using the C terminal of HCG_2042202 as the immunogen</p>

PCDHA4 antibody was raised using the C terminal of PCDHA4 corresponding to a region with amino acids SGYNAWLSYELQPETASASIPFRVGLYTGEISTTRALDETDAPRQRLLVL

<p>ATP6V1A antibody was raised using the N terminal of ATP6V1A corresponding to a region with amino acids SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR</p>

<p>GOPC antibody was raised using the N terminal of GOPC corresponding to a region with amino acids EVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKA</p>

<p>The Calmodulin antibody is a highly specialized monoclonal antibody that targets and binds to calmodulin, a calcium-binding protein involved in various cellular processes. This antibody is widely used in Life Sciences research and is an essential tool for studying the functions of calmodulin in different biological systems.</p>

<p>C/EBP-beta antibody was raised in mouse using recombinant human C/EBP-beta (1-271 aa) purified from E. coli as the immunogen.</p>

Rabbit polyclonal NMDAR2B antibody (Tyr1336)

<p>The PAK1 antibody is a highly specific antibody used in the field of Life Sciences. It is capable of recognizing and binding to the amino-terminal and carboxyl terminal regions of PAK1, a protein involved in various cellular processes. This antibody can be utilized for a wide range of applications, including immunoassays, Western blotting, immunohistochemistry, and more.</p>

<p>Chlamydia antibody was raised in mouse using Chlamydia antigen as the immunogen.</p>

<p>CHCHD3 antibody was raised using the middle region of CHCHD3 corresponding to a region with amino acids LRERICSEEERAKAKHLARQLEEKDRVLKKQDAFYKEQLARLEERSSEFY</p>

<p>RALB antibody was raised using a synthetic peptide corresponding to a region with amino acids FREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVE</p>

<p>FBXO28 antibody was raised using the middle region of FBXO28 corresponding to a region with amino acids ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK</p>

<p>Rabbit polyclonal Histone H3 antibody (Thr3)</p>

<p>Affinity purified Rabbit polyclonal PDZK3 antibody</p>

<p>Rabbit polyclonal Goat Serum Albumin antibody</p>

<p>CD82 antibody was raised in Rabbit using Human CD82 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal Slap antibody</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids MNESPDPTDLAGVIIELGPNDSPQTSEFKGATEEAPAKESVLARLSKFEV</p>

<p>AKAP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ</p>

<p>Rabbit polyclonal FZD9 antibody</p>

<p>Rabbit Polyclonal p53 antibody (Ser37)</p>

<p>Acid phosphatase antibody (HRP) was raised in rabbit using acid phosphatase as the immunogen.</p>

<p>Purified Polyclonal TCF19 antibody</p>

<p>The JNK antibody is a monoclonal antibody that specifically targets the c-Jun N-terminal kinase (JNK) protein. This antibody is widely used in Life Sciences research to study the role of JNK in various cellular processes. The JNK protein is involved in signal transduction pathways that regulate cell growth, differentiation, and apoptosis. It has been shown to be activated by a variety of stimuli, including growth factors, hormones, and stress signals. The JNK antibody can be used for immunohistochemistry, western blotting, and other experimental techniques to detect and quantify the levels of activated JNK in cells or tissues. Its high specificity and sensitivity make it an essential tool for researchers studying the function of JNK in different biological systems.</p>

<p>Rabbit polyclonal SLC6A3 antibody</p>

<p>Rabbit polyclonal RNR antibody (HRP)</p>

<p>Rabbit Polyclonal JunD antibody</p>

<p>The Histone H3.1 antibody is a highly specialized product in the field of Life Sciences and Antibodies. It is designed to target and detect Histone H3.1, a growth factor that plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>Affinity purified Rabbit polyclonal PRNP antibody</p>

<p>Calreticulin antibody is a polyclonal antibody that acts as an inhibitor of growth factors. It specifically targets low-density lipoprotein receptors and alpha-synuclein, two molecules that play a crucial role in cellular growth and development. Additionally, this antibody has been shown to bind to epidermal growth factor and trastuzumab, both monoclonal antibodies used in cancer treatment. By binding to these molecules, the calreticulin antibody prevents their interaction with nucleotide molecules, inhibiting nuclear signaling and ultimately suppressing cell growth. Furthermore, it exhibits anti-HER2 activity by blocking the amino group of epidermal growth factor receptors. With its multifaceted mechanisms of action, the calreticulin antibody holds promise for various therapeutic applications.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, thus inhibiting bacterial growth and preventing transcription and replication. Extensive research has been conducted on human erythrocytes using a patch-clamp technique, demonstrating its high frequency of human activity. In terms of metabolism, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.</p>

Telomerase antibody is a monoclonal antibody that specifically targets the telomerase enzyme. Telomerase plays a crucial role in maintaining the length of telomeres, which are protective caps at the ends of chromosomes. This antibody binds to the catalytic subunit of telomerase and inhibits its activity, leading to telomere shortening and eventual cell death.

<p>Purified Rabbit polyclonal EEF1E1 antibody</p>

GCN5L2 antibody was raised in mouse using recombinant human GCN5L2 (411-837aa) purified from E. coli as the immunogen.

SUPT4H1 antibody was raised in mouse using recombinant Human Suppressor Of Ty 4 Homolog 1 (S. Cerevisiae) (Supt4H1)

Bcl-2 antibody was raised in mouse using recombinant human Bcl-2 (1-211aa) purified from E. coli as the immunogen.

ADNP antibody was raised in mouse using recombinant Human Activity-Dependent Neuroprotector Homeobox

<p>Rabbit polyclonal CXCL10 antibody (HRP)</p>

<p>Purified Polyclonal HMGA1 antibody</p>

<p>Purified Rabbit polyclonal OR6C70 antibody</p>