Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,776 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75326 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Amphetamine antibody
Mouse monoclonal antibody against amphetmine. Amphetamine antibody was raised in Mouse using Amphetamine conjugated to BSA as the immunogenIFN beta antibody
<p>IFN beta antibody was raised in mouse using human interferon beta as the immunogen.</p>TSPYL6 antibody
<p>TSPYL6 antibody was raised using the N terminal of TSPYL6 corresponding to a region with amino acids MSLPESPHSPATLDYALEDPHQGQRSREKSKATEVMADMFDGRLEPIVFP</p>PNPO antibody
<p>PNPO antibody was raised using the N terminal of PNPO corresponding to a region with amino acids PMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLAT</p>SULT2B1 antibody
<p>SULT2B1 antibody was raised using the middle region of SULT2B1 corresponding to a region with amino acids YSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFI</p>CD3 antibody (Spectral Red)
<p>CD3 antibody (Spectral Red) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.</p>Septin 10 antibody
<p>Septin 10 antibody was raised using the C terminal of 40431 corresponding to a region with amino acids ERMKLEEKRRLLEEEIIAFSKKKATSEIFHSQSFLATGSNLRKDKDRKNS</p>ACD antibody
<p>ACD antibody was raised using a synthetic peptide corresponding to a region with amino acids KNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQ</p>BID antibody
BID antibody was raised in mouse using recombinant human BID (1-195aa) purified from E. coli as the immunogen.TNF alpha antibody
<p>TNF alpha antibody is a specific antibody that targets tumor necrosis factor-alpha (TNF-α), a cytokine involved in inflammation and immune response. This antibody is widely used in Life Sciences research to study the role of TNF-α in various biological processes. It can be used for applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry.</p>Mouse anti Human IgE
Human IgE antibody was raised in mouse using human myeloma IgE as the immunogen.MMP1 antibody
The MMP1 antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets the matrix metalloproteinase 1 (MMP1), an enzyme involved in the breakdown of collagen. This antibody can be used to detect and quantify MMP1 levels in various samples, such as tissue lysates or cell culture supernatants.Troponin I antibody (Cardiac)
<p>Troponin I antibody (cardiac) was raised in mouse using amino acid residues 186-192 of cTnI as the immunogen.</p>TRIM2 antibody
The TRIM2 antibody is a monoclonal antibody that specifically targets collagen. It is widely used in the field of Life Sciences for its neutralizing properties. This antibody has been extensively studied and proven to effectively bind to its target, making it a valuable tool in research and diagnostics. The TRIM2 antibody recognizes a conformational epitope on collagen, allowing for precise and accurate detection. It has also been shown to have cytotoxic effects on low-density cells, further highlighting its potential therapeutic applications. With its high specificity and reliability, the TRIM2 antibody is an essential component in various scientific experiments and studies.PCNA antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is known to be the most effective rifamycin for treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Extensive research has proven its high activity in human erythrocytes using a patch-clamp technique. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Rifapentine also specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.PPIL2 antibody
<p>PPIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ</p>CENPQ antibody
<p>CENPQ antibody was raised using the N terminal of CENPQ corresponding to a region with amino acids VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHL</p>XIAP antibody
<p>The XIAP antibody is a monoclonal antibody that specifically targets the X-linked inhibitor of apoptosis protein (XIAP). This protein plays a crucial role in regulating cell death and survival pathways. The XIAP antibody has been extensively studied and proven to be highly effective in neutralizing the function of XIAP, thereby promoting apoptosis in cancer cells.</p>SNX27 antibody
The SNX27 antibody is a highly effective monoclonal antibody used in Life Sciences. It is specifically designed to target thrombocytopenia, a condition characterized by low platelet count. This powerful antibody works by binding to specific receptors on the surface of platelets, promoting their activation and preventing their destruction. In addition to its role in treating thrombocytopenia, the SNX27 antibody has also shown promise in other areas of research. It can be used in assays to detect and quantify various proteins, such as collagen and anti-mesothelin antibodies. Furthermore, this antibody has been found to inhibit the activity of urokinase plasminogen activator, an enzyme involved in blood clot dissolution. With its cytotoxic properties and ability to neutralize inhibitors present in human serum, the SNX27 antibody is a valuable tool for both laboratory research and therapeutic applications.NUMB antibody
The NUMB antibody is a monoclonal antibody that specifically targets adiponectin, a growth factor found in adipose tissue. This antibody is widely used in Life Sciences research to study the role of adiponectin in various physiological processes. It has been shown to be effective in detecting and quantifying adiponectin levels in samples such as serum, plasma, and cell lysates. The NUMB antibody can also be used for immunohistochemistry and Western blot analysis to visualize the expression of adiponectin in different tissues. Additionally, this antibody has been used to investigate the presence of autoantibodies against adiponectin in certain diseases, including insulin resistance and diabetes. Its high specificity and sensitivity make it a valuable tool for researchers studying adipocyte biology and related disorders.RABEP1 antibody
<p>The RABEP1 antibody is a polyclonal antibody that has high specificity for interferon and alpha-fetoprotein. It recognizes specific glycan and fatty acid molecules and can be used in various applications in the field of Life Sciences. This monoclonal antibody exhibits high specific activity, making it a valuable tool for research purposes. It can be used to detect the presence of RABEP1 protein in samples such as human serum or cell lysates. Additionally, this antibody has been shown to have superoxide activity and may play a role in regulating lipoprotein lipase activity. With its versatility and reliability, the RABEP1 antibody is an essential component for any laboratory conducting research in these areas.</p>PGM2L1 antibody
PGM2L1 antibody was raised using the N terminal of PGM2L1 corresponding to a region with amino acids KEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNGSWNDNLVDTSPLKBCL2 antibody
The BCL2 antibody is a highly specialized monoclonal antibody that targets the B-cell lymphoma 2 (BCL2) protein, which plays a crucial role in regulating cell survival. This antibody specifically binds to the BCL2 protein, inhibiting its function and promoting apoptosis (cell death) in cancer cells.PYGB antibody
<p>PYGB antibody was raised using the N terminal of PYGB corresponding to a region with amino acids ADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLDTQVVLAMPYDT</p>
