Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,776 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75326 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
ZFP36L1 antibody
<p>The ZFP36L1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to the ZFP36L1 protein, which plays a crucial role in regulating gene expression. This antibody has been extensively tested and validated for its specificity and reliability.</p>HIV1 p24 antibody (biotin)
HIV1 p24 antibody (biotin) was raised in goat using purified native p24 from strain IIIB as the immunogen.CD41a antibody
<p>The CD41a antibody is a monoclonal antibody that specifically binds to CD41a, a protein involved in platelet aggregation and blood clot formation. This antibody can be used in various research applications, including flow cytometry, immunohistochemistry, and Western blotting. It has been shown to effectively detect CD41a in human serum, adipose tissue, and other biological samples. The CD41a antibody can also be conjugated to various detection molecules, such as fluorescent dyes or enzymes, for visualization purposes. Its high specificity and sensitivity make it an essential tool for studying platelet function and related disorders.</p>RAMP2 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections as it has strong bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>DAB1 antibody
<p>DAB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PTTDDIFEEGFESPSKSEEQEAPDGSQASSNSDPFGEPSGEPSGDNISPQ</p>Mad2L1 Antibody
<p>The Mad2L1 Antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to the Mad2L1 protein, which plays a crucial role in cell division and growth regulation. This antibody is buffered and optimized for maximum stability and performance.</p>HBsAg antibody
<p>hepatitis B antibody was raised in mouse using hepatitis B surface antigen as the immunogen.</p>FGF basic antibody (biotin)
FGF basic antibody (biotin) was raised in rabbit using highly pure recombinant human FGF-basic as the immunogen.Akt antibody (Tyr326)
<p>Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific protein kinase that plays a central role in various cellular processes. It's a key player in the PI3K/Akt/mTOR pathway, which is essential for regulating cell growth, survival, metabolism, and proliferation.Structure: Akt has three main isoforms in humans (Akt1, Akt2, and Akt3), each encoded by different genes. Activation: Akt activation is typically initiated by external signals, such as growth factors or insulin, that bind to cell surface receptors. This activates phosphoinositide 3-kinase (PI3K), which then produces phosphatidylinositol (3,4,5)-trisphosphate (PIP3) on the cell membrane. PIP3 then recruits Akt to the membrane where it is activated by two key phosphorylation events at Thr308 and Ser473. Once fully activated, Akt can move to different parts of the cell to phosphorylate its target proteins.The key functions of Akt include:Cell Survival and Anti-Apoptosis: Akt inhibits apoptosis by phosphorylating and inactivating several pro-apoptotic proteins, such as BAD and Caspase-9.Cell Growth and Proliferation: By promoting protein synthesis and inhibiting pathways that would otherwise halt the cell cycle, Akt encourages cell growth. It activates mTOR, a major regulator of protein synthesis and cellular growth.Metabolic Regulation: Akt influences metabolism by increasing glucose uptake and glycolysis, primarily through GLUT4 translocation and hexokinase activation, which is especially important in muscle and adipose tissues.Angiogenesis: Akt can stimulate the growth of new blood vessels by increasing the expression of VEGF (vascular endothelial growth factor), supporting tissue growth and repair.Cell Migration and Invasion: Akt is involved in processes that facilitate cell motility, aiding in wound healing and, unfortunately, in the spread of cancer cells.Given its role in promoting cell survival and growth, Akt is frequently hyperactivated in cancers, leading to uncontrolled cell division and tumor growth. Many cancer therapies target the PI3K/Akt/mTOR pathway to suppress this hyperactivity. Furthermore Akt's role in regulating glucose metabolism links it to insulin signaling. Defects in this pathway can impair glucose uptake, contributing to insulin resistance and type 2 diabetes.</p>BAT1 antibody
<p>BAT1 antibody was raised using the N terminal of BAT1 corresponding to a region with amino acids MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDF</p>MNS1 antibody
<p>MNS1 antibody was raised using the middle region of MNS1 corresponding to a region with amino acids KVQENEEKRLQLQNALTQKLEEMLRQREDLEQVRQELYQEEQAEIYKSKL</p>Fukutin antibody
<p>The Fukutin antibody is a specific antibody that belongs to the group of Polyclonal Antibodies. It is an immunosuppressant and growth factor that plays a crucial role in various biological processes. This antibody can be used in research laboratories for studying protein-protein interactions, as well as in clinical settings for diagnostic purposes.</p>STAT3 antibody
<p>The STAT3 antibody is a highly effective steroid that belongs to the class of Polyclonal Antibodies. It is also available as a monoclonal antibody, offering versatility in research applications. Produced through hybridoma cell technology, this antibody is widely used in Life Sciences for various studies and experiments.</p>Fetuin A antibody
<p>Fetuin A antibody is a highly specific monoclonal antibody that targets the protein fetuin A. This protein plays a crucial role in various biological processes, including collagen synthesis, growth factor signaling, and protein kinase activation. The antibody recognizes specific acid residues on the fetuin A protein and effectively inhibits its activity.</p>ANKRD5 antibody
<p>ANKRD5 antibody was raised using the middle region of ANKRD5 corresponding to a region with amino acids LDIGAKFQLENRKGHSAMDVAKAYADYRIIDLIKEKLDNLPKPAENQKLK</p>MRPL15 antibody
<p>MRPL15 antibody was raised using the C terminal of MRPL15 corresponding to a region with amino acids KDELFKMLCTRKDPRQIFFGLAPGWVVNMADKKILKPTDENLLKYYTS</p>SRPK1 antibody
<p>SRPK1 antibody was raised in rabbit using the C terminal of SRPK1 as the immunogen</p>MMP8 antibody
<p>The MMP8 antibody is a monoclonal antibody that specifically targets matrix metalloproteinase 8 (MMP8). This antibody has been extensively studied and shown to have various characteristics and applications.</p>TGFBI antibody
<p>The TGFBI antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and binds to the Transforming Growth Factor Beta-Induced (TGFBI) protein. This protein plays a crucial role in various biological processes, including cell adhesion, migration, and tissue development.</p>Human Growth Hormone antibody
<p>Human growth hormone antibody was raised in mouse using human growth hormone as the immunogen.</p>HSDL1 antibody
<p>HSDL1 antibody was raised in rabbit using the C terminal of HSDL1 as the immunogen</p>Rat Thymocyte antibody
Rat thymocyte antibody was raised in rabbit using RBC-free rat thymocytes as the immunogen.
