Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,776 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75326 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
EphA6 antibody
<p>EphA6 antibody was raised in Mouse using a purified recombinant fragment of EphA6(aa695-795) expressed in E. coli as the immunogen.</p>ELK1 antibody
<p>The ELK1 antibody is a powerful tool in the field of Life Sciences. As an antiestrogen, it plays a crucial role in regulating the effects of interleukin-6, a key cytokine involved in immune response and inflammation. This monoclonal antibody is designed to specifically target and neutralize ELK1, an important transcription factor involved in cell growth and proliferation.</p>MARVELD2 antibody
<p>MARVELD2 antibody was raised in Rabbit using Human MARVELD2 as the immunogen</p>RPA2 antibody
The RPA2 antibody is a highly effective tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to RPA2, a protein involved in DNA replication and repair. This antibody can be used for various applications, including immunofluorescence, immunohistochemistry, and Western blotting.ERK1 + ERK2 antibody
ERK1/2 antibody was raised in mouse using full length recombinant human ERK1 protein as the immunogen.WBP2 antibody
<p>WBP2 antibody was raised using the N terminal of WBP2 corresponding to a region with amino acids MKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQ</p>HNRPDL antibody
<p>HNRPDL antibody was raised using the middle region of HNRPDL corresponding to a region with amino acids TMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYL</p>CD154 antibody
CD154 antibody is a protein that belongs to the class of polyclonal antibodies. It is used in the field of Life Sciences as an inhibitor of epidermal growth factor (EGF). CD154 antibody specifically binds to CD154, a protein expressed on the surface of activated T cells. This binding prevents the interaction between CD154 and its receptors, leading to the inhibition of T cell activation and subsequent immune responses. CD154 antibody has also been shown to inhibit the activity of dopamine β-hydroxylase, an enzyme involved in the synthesis of norepinephrine. Additionally, it has been demonstrated to bind to liver microsomes and modulate their function. CD154 antibody can be used as a monoclonal antibody for various research purposes, including studying protein-protein interactions, identifying binding proteins, and investigating hydration dynamics. Its unique properties make it a valuable tool in the field of Life Sciences.CACNG6 antibody
<p>CACNG6 antibody was raised using the N terminal of CACNG6 corresponding to a region with amino acids RAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKAN</p>Kir4.1 antibody
The Kir4.1 antibody is a highly specific monoclonal antibody that targets the protein Kir4.1. This protein plays a crucial role in regulating potassium ion channels in the central nervous system. The antibody binds to Kir4.1 and inhibits its activity, leading to a decrease in potassium ion conductance.LOX antibody
<p>The LOX antibody is a monoclonal antibody that has been developed for ultrasensitive detection in immunoassays. It is derived from hybridoma cells and specifically targets LOX (lysyl oxidase), an enzyme involved in the cross-linking of collagen and elastin fibers. This antibody has been extensively characterized using various techniques, including electrochemical impedance and colloidal gold-based assays. It exhibits high specificity and affinity for LOX, making it an ideal tool for research in the Life Sciences field. The LOX antibody can be used for the immobilization of cytotoxic T-lymphocyte cells on an electrode surface, enabling the detection and analysis of these cells in complex biological samples. Its phosphatase activity allows for signal amplification, resulting in enhanced sensitivity in immunoassays. With its exceptional performance and reliability, the LOX antibody is a valuable asset for scientists conducting cutting-edge research in various fields.</p>MAP2 antibody
<p>The MAP2 antibody is a highly specialized antibody used in Life Sciences research. It plays a crucial role in neutralizing the effects of glutamate, a growth factor involved in various cellular processes. This monoclonal antibody specifically targets endothelial growth and has been shown to inhibit the proliferation and migration of endothelial cells. Additionally, it has been found to bind to alpha-synuclein, a protein associated with neurodegenerative diseases like Parkinson's. The MAP2 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific needs. Its application extends beyond basic research, as it can be used in studies involving mesenchymal stem cells and microvessel density analysis. With its high specificity and sensitivity, the MAP2 antibody is an invaluable tool for scientists aiming to understand complex biological processes at the molecular level.</p>FAS antibody
<p>FAS antibody was raised using a synthetic peptide corresponding to a region with amino acids KKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV</p>MYD88 antibody
The MYD88 antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets and binds to MYD88, an important protein involved in various cellular processes. This antibody has been extensively studied and proven to have numerous applications.CD117 antibody
<p>CD117 antibody was raised in mouse using human MO7e tumor cells as the immunogen.</p>AMBP antibody
The AMBP antibody is a monoclonal antibody that targets the colony-stimulating factor and TNF-related apoptosis-inducing ligand (TRAIL). It acts as an inhibitor of these factors, preventing their activity and promoting cell survival. This antibody has been shown to have therapeutic potential in various life sciences applications, including cancer research and treatment. It has also been found to inhibit the growth of microvessels, which may be beneficial in controlling angiogenesis. Additionally, the AMBP antibody has demonstrated its efficacy in modulating immune responses by targeting TNF-α and fibrinogen. Its versatility and specificity make it a valuable tool for researchers in the field of immunology and molecular biology.FBXW10 antibody
<p>FBXW10 antibody was raised using the N terminal of FBXW10 corresponding to a region with amino acids SPEKDHSSKSATSQVYWTAKTQHTSLPLSKAPENEHLLGAASNPEEPWRN</p>CCDC128 antibody
<p>CCDC128 antibody was raised using the N terminal of CCDC128 corresponding to a region with amino acids KRVELLQDELALSEPRGKKNKKSGESSSQLSQEQKSVFDEDLQKKIEENE</p>HAND1 antibody
<p>HAND1 antibody was raised in Mouse using a purified recombinant fragment of HAND1(aa90-190) expressed in E. coli as the immunogen.</p>DDX47 antibody
<p>DDX47 antibody was raised using a synthetic peptide corresponding to a region with amino acids AAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQ</p>CXCL5 antibody
The CXCL5 antibody is a monoclonal antibody that targets and neutralizes the activity of CXCL5, a growth factor involved in various biological processes. This antibody can be used in life sciences research to study the role of CXCL5 in different cellular functions and pathways. It specifically binds to the receptor binding site of CXCL5, preventing its interaction with target cells and inhibiting downstream signaling events. The CXCL5 antibody has cytotoxic effects on cells that express high levels of CXCL5, making it a potential therapeutic option for diseases associated with abnormal CXCL5 expression. Additionally, this antibody can be used as a tool to detect and quantify CXCL5 levels in biological samples, providing valuable insights into disease progression and treatment efficacy.Met antibody
<p>The Met antibody is a monoclonal antibody that targets the hepatocyte growth factor (HGF) receptor, also known as Met. This antibody has been shown to inhibit the activation of Met by HGF in human serum, making it a potential therapeutic option for diseases associated with aberrant Met signaling. The Met antibody specifically binds to the extracellular domain of the Met receptor, preventing its interaction with HGF and subsequent downstream signaling events. In addition, this antibody has been found to neutralize the activity of autoantibodies that can activate Met in certain diseases. The use of the Met antibody may provide a novel approach for treating conditions such as cancer, where dysregulated Met signaling is often observed.</p>NGAL antibody
<p>The NGAL antibody is a highly specialized binding protein that targets the necrosis factor-related apoptosis-inducing ligand (TRAIL) and alpha-fetoprotein (AFP). Developed by Life Sciences, this monoclonal antibody is designed to specifically bind to these target molecules in human serum. By binding to TRAIL and AFP, the NGAL antibody inhibits their protease activity and prevents their interaction with receptors on cell surfaces.</p>CHRNA4 antibody
<p>CHRNA4 antibody was raised in rabbit using the N terminal of CHRNA4 as the immunogen</p>TALDO1 antibody
<p>The TALDO1 antibody is a highly specialized protein that belongs to the group of polyclonal antibodies. It is used in life sciences research to detect and study transaldolase, an important enzyme involved in nucleic acid metabolism. This antibody specifically binds to TALDO1, making it a valuable tool for identifying and quantifying this biomarker in various biological samples. By targeting specific polypeptides, the TALDO1 antibody enables researchers to gain insights into the role of transaldolase in cellular processes and disease development. Its high specificity and sensitivity make it an essential component in many scientific experiments and studies.</p>
