Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
NUDCD1 antibody
NUDCD1 antibody was raised using the N terminal of NUDCD1 corresponding to a region with amino acids EVAANCSLRVKRPLLDPRFEGYKLSLEPLPCYQLELDAAVAEVKLRDDQY
CAB39 antibody
CAB39 antibody was raised using the middle region of CAB39 corresponding to a region with amino acids KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPAKT1 antibody
The AKT1 antibody is a cholinergic monoclonal antibody that targets the AKT1 protein. It plays a crucial role in various cellular processes, including cell survival, growth, and proliferation. This antibody specifically binds to the AKT1 protein, inhibiting its function and preventing downstream signaling pathways.H2AFX antibody
H2AFX antibody was raised using the N terminal of H2AFX corresponding to a region with amino acids SGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYRBM38 antibody
RBM38 antibody was raised using the N terminal of RBM38 corresponding to a region with amino acids LPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERATR antibody
The ATR antibody is a polyclonal antibody that is commonly used in Life Sciences research. It specifically targets the epidermal growth factor (EGF) and epinephrine, two important hormones involved in cell growth and signaling pathways. This antibody has been shown to have neutralizing effects on EGF-like inhibitory factors, which can block the activity of EGF and other growth factors. Additionally, the ATR antibody can also bind to albumin and serum albumin, two proteins commonly found in human serum. This makes it a valuable tool for studying protein-protein interactions and identifying potential therapeutic targets. Whether you're conducting research or developing new treatments, the ATR antibody is an essential tool for any scientist in the field of Life Sciences.
ERK1/2 antibody
The ERK1/2 antibody is a highly specialized monoclonal antibody that targets the nuclear region of cells. It is designed to detect and bind to specific proteins involved in the ERK1/2 signaling pathway, which plays a crucial role in various cellular processes such as cell proliferation, differentiation, and survival.CHK1 antibody
The CHK1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to CHK1, a protein involved in cell cycle regulation and DNA damage response. This antibody has been extensively studied for its potential therapeutic applications, particularly in cancer treatment.LTA4H antibody
The LTA4H antibody is a highly specific monoclonal antibody that targets the lipoprotein lipase and triglyceride lipase, which are enzymes involved in lipid metabolism. It is widely used in Life Sciences research for studying lipid-related disorders and diseases.Lck antibody
The Lck antibody is a highly specific monoclonal antibody that targets the Lck protein, a tyrosine kinase involved in T-cell signaling. It is commonly used in research and diagnostic applications to study the role of Lck in various cellular processes. The Lck antibody recognizes a specific epitope on the Lck protein and can be used for immunoprecipitation, Western blotting, flow cytometry, and immunofluorescence experiments. This antibody has been extensively validated and shown to have high specificity and sensitivity. It is available as both a monoclonal antibody and a polyclonal antibody, allowing researchers to choose the best option for their specific needs. Whether you are studying T-cell activation, immune response, or signal transduction pathways, the Lck antibody is an essential tool for your research. Trust in its quality and reliability to advance your understanding of cellular biology.
PDS5A antibody
The PDS5A antibody is an activated anti-HER2 antibody that falls under the category of Life Sciences. It is specifically designed to target and bind to epidermal growth factor receptors, inhibiting their activity. This biomolecule plays a crucial role in cell growth and division. The PDS5A antibody recognizes the amino group of HER2, preventing its interaction with other growth factors and impeding tumor cell proliferation.HSP90AB1 antibody
The HSP90AB1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to the HSP90AB1 protein, which plays a crucial role in various cellular processes. This antibody is particularly effective in studying glycan modifications of the HSP90AB1 protein.CSA antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. The high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
CYP2D6 antibody
The CYP2D6 antibody is a polyclonal antibody that specifically targets the CYP2D6 enzyme. This enzyme is responsible for metabolizing a wide range of drugs, including bufuralol and interferon. The CYP2D6 antibody recognizes immunodominant epitopes on the enzyme and can be used in various research applications.
Donkey anti Rat IgG (H + L) (HRP)
Donkey anti-rat IgG (H + L) (HRP) was raised in donkey using rat IgG (H&L) as the immunogen.NBEAL1 antibody
NBEAL1 antibody was raised using the N terminal of NBEAL1 corresponding to a region with amino acids KDNDKNMSTEDTKKNSDEKTDEEKITSFASANVSSDQWSLEDRHSLDSNTNNAT antibody
NNAT antibody was raised using the middle region of NNAT corresponding to a region with amino acids MAAVAAASAELLIIGWYIFRVLLQVFRYSLQKLAYTVSRTGRQVLGERRQCD62L antibody
CD62L antibody was raised in mouse using mouse pre-B cells expressing human L-selectin as the immunogen.ROCK2 antibody
The ROCK2 antibody is a highly effective antigen inhibitor that is used in Life Sciences research. It is commonly used in experiments involving annexin and extracellular proteins. This antibody is available in both monoclonal and polyclonal forms, allowing researchers to choose the best option for their specific needs. The ROCK2 antibody can be used in various applications, including luminescent and fluorescent assays, as well as in multi-well plate experiments. It is also compatible with recombinant cells and other inhibitors commonly used in the field of Life Sciences. With its high specificity and efficacy, the ROCK2 antibody is a valuable tool for researchers looking to study the role of ROCK2 in cellular processes.
