Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,621 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
PM20D1 antibody
The PM20D1 antibody is a specific antibody that targets the PM20D1 antigen. It is commonly used in Life Sciences research to study the role of PM20D1 in various biological processes. This antibody is particularly useful as a serum marker for detecting the presence of PM20D1 in biological samples. It can be used in techniques such as immunohistochemistry and Western blotting to visualize and quantify the expression of PM20D1. Additionally, this antibody can be used as a tool to investigate the potential therapeutic applications of PM20D1 inhibitors or as a diagnostic tool for detecting autoantibodies against PM20D1. Its high specificity and sensitivity make it an essential component in many research studies related to dopamine metabolism, zinc chelation, fetal hemoglobin regulation, and other areas of interest in the field of Life Sciences.
GPT2 antibody
GPT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGBeta-2-microglobulin monoclonal antibody
The Beta-2-microglobulin monoclonal antibody is a highly specialized antibody that targets and interacts with beta-2-microglobulin, a protein found on the surface of various cells. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in different applications.MDM2 antibody
The MDM2 antibody is a neutralizing monoclonal antibody that targets the MDM2 protein. It has been shown to inhibit the activity of interleukin-6 (IL-6) and tumor necrosis factor-alpha (TNF-α), two pro-inflammatory cytokines involved in immune responses. This antibody is reactive against adipose tissue and has been used in studies involving conditions such as obesity and metabolic disorders. Additionally, the MDM2 antibody has shown potential therapeutic effects against Brucella abortus, a bacterial pathogen that causes brucellosis. The colloidal gold-labeled MDM2 antibody can be used for immunohistochemistry or immunocytochemistry applications. This antibody also demonstrates inhibitory activity against certain family kinases and amyloid proteins. Overall, the MDM2 antibody offers a versatile tool for researchers studying various biological processes and diseases related to MDM2 and its associated pathways.delta Catenin antibody
delta Catenin antibody was raised in mouse using synthetic peptide J6 (corresponding to aa 292-309) coupled to KLH as the immunogen.Cat RBC antibody (FITC)
Feline RBC antibody (FITC) was raised in rabbit using feline erythrocytes as the immunogen.PIN4 antibody
PIN4 antibody was raised using the N terminal of PIN4 corresponding to a region with amino acids MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSADDBH antibody
DBH antibody was raised in mouse using rat dopamine beta-hydroxylase emulsified in freund's adjuvant as the immunogen.Goat anti Armenian Hamster IgG (H + L) (biotin)
Goat anti-armenian hamster IgG (H + L) (biotin) was raised in goat using hamster IgG (H & L) as the immunogen.COL1A2 antibody
The COL1A2 antibody is a highly specialized monoclonal antibody that targets the nuclear protein COL1A2. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody has been found to have inhibitory effects on epidermal growth factor (EGF) signaling pathways, making it a potential therapeutic option for diseases related to EGF dysregulation.
β Tubulin 2A antibody
Beta Tubulin 2A antibody was raised using the N terminal of TUBB2A corresponding to a region with amino acids MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLVIFN alpha antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. It has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their growth in culture.CA9 antibody
The CA9 antibody is a monoclonal antibody that has been extensively studied in the field of Life Sciences. It has shown promising results in various applications, including its ability to neutralize aldehyde and interferon autoantibodies. This antibody has a high affinity for low-density albumin and acidic proteins, making it an excellent tool for research purposes. Additionally, the CA9 antibody has been used in studies related to collagen and growth factors, further highlighting its versatility in the field of molecular biology. With its exceptional specificity and binding capacity, this monoclonal antibody is a valuable asset for any laboratory or research facility.KRT5 antibody
The KRT5 antibody is a highly effective substance used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to the keratin 5 (KRT5) protein, which is commonly found in collagen-rich tissues. This antibody has been extensively tested and validated for its specificity and reliability.ACADS antibody
ACADS antibody was raised using the middle region of ACADS corresponding to a region with amino acids FTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITNAWEASSTR1 antibody
The SSTR1 antibody is a powerful tool used in Life Sciences research. It belongs to the class of antibodies and serves as a serum marker for various studies. This antibody specifically targets glycogen synthase kinase, which plays a crucial role in cell signaling and regulation. The SSTR1 antibody can be used as an active agent in experiments involving anti-mesothelin, telomerase, and methyl transferase. It is also widely used in Polyclonal Antibody assays to detect the presence of specific proteins or glycoproteins. Researchers rely on the SSTR1 antibody to explore interferon-stimulated gene expression and develop inhibitors for chloride channels. With its diverse applications, this antibody is an essential component in the development of new medicines and therapies.GATA4 antibody
The GATA4 antibody is a highly specialized monoclonal antibody that is used in the field of life sciences. It specifically targets the GATA4 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in detecting autoantibodies against GATA4.Aprotinin antibody
The Aprotinin antibody is a highly specialized and effective tool in the field of Life Sciences. It is a monoclonal antibody that has been developed for use in bioassays, specifically targeting the adeno-associated virus (AAV). This antibody can be used to detect and quantify AAV in various samples, including human serum. Additionally, it has shown potential for use in the detection of alpha-fetoprotein and steroids.IGF2BP2 antibody
The IGF2BP2 antibody is a highly reactive and neutralizing monoclonal antibody that targets the insulin-like growth factor 2 mRNA-binding protein 2 (IGF2BP2). This antibody has been extensively studied in the field of Life Sciences and has shown great potential for therapeutic applications.LDHA antibody
The LDHA antibody is a monoclonal antibody that is used in the field of life sciences. It specifically targets lactate dehydrogenase A (LDHA), an enzyme involved in the conversion of pyruvate to lactate during anaerobic glycolysis. By inhibiting LDHA, this antibody can help researchers study the role of lactate metabolism in various biological processes. Whether you're conducting research or developing new therapeutic strategies, the LDHA antibody is a valuable tool for understanding and manipulating lactate levels in cells and tissues. Trust in its specificity and reliability to advance your scientific endeavors.P2X1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, this drug specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.SIRPG antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is specifically designed to combat tuberculosis infections. With its bactericidal activity, this compound effectively inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed in high levels in Mycobacterium tuberculosis strains, inhibiting their growth in culture.TAB2 antibody
TAB2 antibody was raised in Mouse using a purified recombinant fragment of human TAB2 expressed in E. coli as the immunogen.
