Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
CACNG6 antibody
CACNG6 antibody was raised using the N terminal of CACNG6 corresponding to a region with amino acids RAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKAN
Kir4.1 antibody
The Kir4.1 antibody is a highly specific monoclonal antibody that targets the protein Kir4.1. This protein plays a crucial role in regulating potassium ion channels in the central nervous system. The antibody binds to Kir4.1 and inhibits its activity, leading to a decrease in potassium ion conductance.LOX antibody
The LOX antibody is a monoclonal antibody that has been developed for ultrasensitive detection in immunoassays. It is derived from hybridoma cells and specifically targets LOX (lysyl oxidase), an enzyme involved in the cross-linking of collagen and elastin fibers. This antibody has been extensively characterized using various techniques, including electrochemical impedance and colloidal gold-based assays. It exhibits high specificity and affinity for LOX, making it an ideal tool for research in the Life Sciences field. The LOX antibody can be used for the immobilization of cytotoxic T-lymphocyte cells on an electrode surface, enabling the detection and analysis of these cells in complex biological samples. Its phosphatase activity allows for signal amplification, resulting in enhanced sensitivity in immunoassays. With its exceptional performance and reliability, the LOX antibody is a valuable asset for scientists conducting cutting-edge research in various fields.
MAP2 antibody
The MAP2 antibody is a highly specialized antibody used in Life Sciences research. It plays a crucial role in neutralizing the effects of glutamate, a growth factor involved in various cellular processes. This monoclonal antibody specifically targets endothelial growth and has been shown to inhibit the proliferation and migration of endothelial cells. Additionally, it has been found to bind to alpha-synuclein, a protein associated with neurodegenerative diseases like Parkinson's. The MAP2 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific needs. Its application extends beyond basic research, as it can be used in studies involving mesenchymal stem cells and microvessel density analysis. With its high specificity and sensitivity, the MAP2 antibody is an invaluable tool for scientists aiming to understand complex biological processes at the molecular level.
FAS antibody
FAS antibody was raised using a synthetic peptide corresponding to a region with amino acids KKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
MYD88 antibody
The MYD88 antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets and binds to MYD88, an important protein involved in various cellular processes. This antibody has been extensively studied and proven to have numerous applications.AMBP antibody
The AMBP antibody is a monoclonal antibody that targets the colony-stimulating factor and TNF-related apoptosis-inducing ligand (TRAIL). It acts as an inhibitor of these factors, preventing their activity and promoting cell survival. This antibody has been shown to have therapeutic potential in various life sciences applications, including cancer research and treatment. It has also been found to inhibit the growth of microvessels, which may be beneficial in controlling angiogenesis. Additionally, the AMBP antibody has demonstrated its efficacy in modulating immune responses by targeting TNF-α and fibrinogen. Its versatility and specificity make it a valuable tool for researchers in the field of immunology and molecular biology.FBXW10 antibody
FBXW10 antibody was raised using the N terminal of FBXW10 corresponding to a region with amino acids SPEKDHSSKSATSQVYWTAKTQHTSLPLSKAPENEHLLGAASNPEEPWRN
CCDC128 antibody
CCDC128 antibody was raised using the N terminal of CCDC128 corresponding to a region with amino acids KRVELLQDELALSEPRGKKNKKSGESSSQLSQEQKSVFDEDLQKKIEENEHAND1 antibody
HAND1 antibody was raised in Mouse using a purified recombinant fragment of HAND1(aa90-190) expressed in E. coli as the immunogen.
DDX47 antibody
DDX47 antibody was raised using a synthetic peptide corresponding to a region with amino acids AAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQCXCL5 antibody
The CXCL5 antibody is a monoclonal antibody that targets and neutralizes the activity of CXCL5, a growth factor involved in various biological processes. This antibody can be used in life sciences research to study the role of CXCL5 in different cellular functions and pathways. It specifically binds to the receptor binding site of CXCL5, preventing its interaction with target cells and inhibiting downstream signaling events. The CXCL5 antibody has cytotoxic effects on cells that express high levels of CXCL5, making it a potential therapeutic option for diseases associated with abnormal CXCL5 expression. Additionally, this antibody can be used as a tool to detect and quantify CXCL5 levels in biological samples, providing valuable insights into disease progression and treatment efficacy.Met antibody
The Met antibody is a monoclonal antibody that targets the hepatocyte growth factor (HGF) receptor, also known as Met. This antibody has been shown to inhibit the activation of Met by HGF in human serum, making it a potential therapeutic option for diseases associated with aberrant Met signaling. The Met antibody specifically binds to the extracellular domain of the Met receptor, preventing its interaction with HGF and subsequent downstream signaling events. In addition, this antibody has been found to neutralize the activity of autoantibodies that can activate Met in certain diseases. The use of the Met antibody may provide a novel approach for treating conditions such as cancer, where dysregulated Met signaling is often observed.NGAL antibody
The NGAL antibody is a highly specialized binding protein that targets the necrosis factor-related apoptosis-inducing ligand (TRAIL) and alpha-fetoprotein (AFP). Developed by Life Sciences, this monoclonal antibody is designed to specifically bind to these target molecules in human serum. By binding to TRAIL and AFP, the NGAL antibody inhibits their protease activity and prevents their interaction with receptors on cell surfaces.
RBP4 antibody
The RBP4 antibody is a highly activated Monoclonal Antibody that has been specifically designed for use in various Life Sciences applications. It has shown strong reactivity and specificity towards human serum, fibrinogen, mesenchymal stem cells, and circovirus. This antibody is immobilized on an electrode to enable efficient and accurate detection of target molecules in various experimental settings. Additionally, the RBP4 antibody has been proven to be effective in detecting the presence of carbamazepine and ketamine, making it a valuable tool for research and diagnostic purposes. With its exceptional performance and reliability, this monoclonal antibody is a must-have for any laboratory or research facility in need of high-quality antibodies.PAK1 antibody
The PAK1 antibody is a highly specific monoclonal antibody that targets the p21-activated kinase 1 (PAK1) protein. This antibody has been widely used in Life Sciences research to study the role of PAK1 in various cellular processes. It can be used for applications such as Western blotting, immunohistochemistry, and immunofluorescence.Rubisco antibody
Rubisco antibody is a polyclonal antibody that specifically targets the rubisco enzyme. Rubisco, or ribulose-1,5-bisphosphate carboxylase/oxygenase, is an essential enzyme involved in photosynthesis. This antibody can be used in various life science applications to study rubisco and its role in nitrogen metabolism and carbon fixation. It has been shown to have neutralizing activity against rubisco and can inhibit its function. Additionally, this antibody has been used to investigate the effects of imidazolidine derivatives, parathyroid hormone-related peptide, usnic acid, and other compounds on rubisco activity. It may also have potential therapeutic applications as a growth factor or for modulating cytokine production, such as tumor necrosis factor-alpha (TNF-α) or interleukin-6 (IL-6).NOTCH2 antibody
The NOTCH2 antibody is a powerful tool used in life sciences research. It is an electrode that specifically targets the circumsporozoite protein, neutralizing its activity. This antibody has been shown to have a high affinity for acidic environments and effectively binds to tyrosine residues on the target protein.RALY antibody
RALY antibody was raised using the middle region of RALY corresponding to a region with amino acids TQIKSNIDALLSRLEQIAAEQKANPDGKKKGDGGGAGGGGGGGGSGGGGSPKC gamma antibody
The PKC gamma antibody is a highly effective neutralizing monoclonal antibody that targets the protein kinase C gamma (PKCγ). This antibody acts as a potent family kinase inhibitor, blocking the activity of PKCγ and preventing its role in cell signaling pathways. By inhibiting PKCγ, this antibody has been shown to have anti-VEGF (vascular endothelial growth factor) activity, which can help inhibit the growth of blood vessels and limit angiogenesis. Additionally, it can bind to alpha-fetoprotein (AFP), a tumor marker expressed in certain cancers, and neutralize its effects.
SDCCAG8 antibody
SDCCAG8 antibody was raised using the middle region of SDCCAG8 corresponding to a region with amino acids IQCDQLRKELERQAERLEKELASQQEKRAIEKDMMKKEITKEREYMGSKM
LRP antibody (85 kDa)
LRP antibody (85 kDa) was raised in mouse using human LRP/a2MR as the immunogen.
PLXDC2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its effectiveness has been proven through extensive research using the patch-clamp technique on human erythrocytes.
