Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Lamin B1 antibody
The Lamin B1 antibody is a highly specific monoclonal antibody that targets the lamin B1 protein. This protein plays a crucial role in maintaining the structural integrity of the cell nucleus and is involved in various cellular processes. The Lamin B1 antibody has been extensively tested and validated for its high affinity and specificity towards lamin B1.
GAPDH antibody
GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCMC1R antibody
The MC1R antibody is a monoclonal antibody that specifically targets the mineralocorticoid receptor (MC1R). It has been shown to interfere with the function of this receptor, which plays a crucial role in regulating various physiological processes. This antibody can be used in life sciences research to study the effects of MC1R activation or inhibition on different cellular pathways.
cRaf antibody
The cRaf antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and inhibit the activity of cRaf, a nuclear protein involved in various cellular processes. This antibody has been extensively studied and characterized for its ability to specifically bind to cRaf and prevent its interaction with other molecules.QRSL1 antibody
QRSL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYSKQYREKRKQNPHSENEDSDWLITGGSSGGSAAAVSAFTCYAALGSDTPIG3 antibody
The PIG3 antibody is a growth factor that specifically targets epidermal growth factor (EGF). It acts as a neutralizing agent against EGF, preventing its activity and downstream signaling pathways. This monoclonal antibody is derived from histidine and has been extensively studied in the field of life sciences. It has shown promising results in preclinical studies as a potential therapeutic agent for various diseases.
D-dimer antibody
The D-dimer antibody is a highly specialized product used in the field of Life Sciences. It is an electrode-activated monoclonal antibody that exhibits cytotoxic properties. This antibody specifically targets transthyretin and acts as an anti-connexin agent. It is commonly used in various assays and tests to detect the presence of D-dimer in human serum, which is an important marker for blood clotting disorders. Additionally, this antibody has shown promising results in interfering with interferon signaling pathways. With its unique immobilization capabilities, the D-dimer antibody offers researchers a powerful tool for studying various biological processes and developing diagnostic tools for related conditions.SHH antibody
The SHH antibody is a monoclonal antibody that specifically targets the Sonic Hedgehog (SHH) protein isoforms. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. The SHH antibody can be used in research studies to investigate the role of SHH in development, cell signaling, and disease processes.Calcyclin antibody
Calcyclin antibody was raised in Mouse using a purified recombinant fragment of calcyclin expressed in E. coli as the immunogen.C2ORF47 antibody
C2ORF47 antibody was raised using the middle region of C2Orf47 corresponding to a region with amino acids GASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLEMX1 antibody
The MX1 antibody is a highly specialized monoclonal antibody that targets the tyrosine kinase receptor. It is widely used in Life Sciences research and has various applications in the field. This antibody specifically binds to fibronectin, a protein involved in cell adhesion and migration. By targeting this receptor, the MX1 antibody can modulate cellular processes and signaling pathways.
FBXO4 antibody
FBXO4 antibody was raised using the middle region of FBXO4 corresponding to a region with amino acids KRMPCFYLAHELHLNLLNHPWLVQDTEAETLTGFLNGIEWILEEVESKRAKlotho antibody
Klotho antibody was raised using the middle region of KL corresponding to a region with amino acids HAQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGDPurity:Min. 95%IL17 antibody
IL17 antibody was raised in goat using highly pure recombinant hIL-17A as the immunogen.
Purity:Min. 95%GPR20 antibody
The GPR20 antibody is a highly effective antibody-drug that belongs to the class of antibodies. It is specifically designed to target and bind to GPR20, a protein receptor involved in various biological processes. This monoclonal antibody has been extensively studied and proven to have high specificity and affinity for GPR20.RPIA antibody
RPIA antibody was raised using a synthetic peptide corresponding to a region with amino acids MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSGINPP5B antibody
The INPP5B antibody is a highly effective substance used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is widely used as a test substance in various research applications. This antibody specifically targets INPP5B, an enzyme involved in the metabolism of inositol phosphates. By inhibiting the activity of INPP5B, this antibody can modulate cellular signaling pathways and provide valuable insights into various cellular processes.
TRAF6 antibody
The TRAF6 antibody is a highly specialized protein that specifically targets TNF-α, a key cytokine involved in inflammation and immune response. By binding to TNF-α, the TRAF6 antibody inhibits its activity and reduces the inflammatory response in the body. This has been shown to have beneficial effects on various conditions related to excessive inflammation, such as autoimmune diseases and chronic inflammatory disorders.Tau antibody
The Tau antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets and binds to the tau protein, which plays a crucial role in the development of neurodegenerative diseases such as Alzheimer's disease. The antibody can be used for various applications, including immunohistochemistry, Western blotting, and ELISA assays.CYP2E1 antibody
The CYP2E1 antibody is a monoclonal antibody used in life sciences research. It specifically targets the CYP2E1 enzyme, which is primarily found in the liver microsomes. This antibody has been widely used to study the role of CYP2E1 in various physiological processes, including drug metabolism, alcohol metabolism, and oxidative stress. It can be used for immunohistochemistry, western blotting, and other molecular biology techniques to detect and quantify the expression levels of CYP2E1 in different tissues and cell types. The CYP2E1 antibody is highly specific and sensitive, making it an essential tool for researchers studying the function and regulation of this important enzyme.
SDHB antibody
SDHB antibody was raised using a synthetic peptide corresponding to a region with amino acids YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEC1D antibody
C1D antibody was raised in rabbit using the middle region of C1D as the immunogenPurity:Min. 95%SARS antibody
SARS antibody was raised using the C terminal of SARS corresponding to a region with amino acids PEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTLGLUT5 antibody
The GLUT5 antibody is a highly effective and versatile tool used in various scientific and medical research applications. This monoclonal antibody specifically targets the GLUT5 protein, which plays a crucial role in the transportation of fructose across cell membranes.SERCA2 antibody
The SERCA2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the nuclear protein SERCA2, which is involved in the regulation of calcium ion transport. This antibody is commonly used to study the role of SERCA2 in various biological processes such as glucose-6-phosphate metabolism and tyrosine phosphorylation. Additionally, it has been utilized in the detection and quantification of autoantibodies, including antiphospholipid antibodies, which are associated with autoimmune disorders. The SERCA2 antibody can also be used as an anti-connexin agent to block gap junction communication and investigate its impact on cellular signaling pathways. Furthermore, this antibody has potential applications as an anticoagulant due to its ability to inhibit collagen-induced platelet aggregation. With its high specificity and versatility, the SERCA2 antibody is a valuable tool for researchers in multiple fields of study.
