Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
NSMCE2 antibody
NSMCE2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDECD8 antibody
The CD8 antibody is a monoclonal antibody that belongs to the family of kinase inhibitors. It is widely used in Life Sciences for its cytotoxic properties. The CD8 antibody targets specific protein complexes and inhibits their function, leading to cell death through apoptosis. This monoclonal antibody has been shown to be effective against various diseases and conditions, including hepatic lipase activity, dopamine regulation, vasoactive intestinal peptide signaling, and necrosis factor-related apoptosis-inducing pathways. With its potent inhibitory effects, the CD8 antibody offers promising therapeutic potential in the field of molecular biology and immunology.
PAWR antibody
The PAWR antibody is a highly specialized product in the field of Life Sciences. It is an antibody specifically designed for the detection and analysis of pluripotent stem cells. Pluripotent stem cells are unique cells with the ability to differentiate into any type of cell in the human body, making them extremely valuable for scientific research and medical applications.
ELF5 antibody
The ELF5 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in studying neurotrophic factors and their effects on progesterone concentration and steroid metabolism. This antibody is specifically designed to target and bind to ELF5, a transcription factor involved in the regulation of various angiogenic factors such as arginase, angptl3, TGF-beta, and growth factor-2.
alpha Crystallin A antibody
alpha Crystallin A antibody was raised in mouse using recombinant human Crystallin alpha A (1-173aa) purified from E. coli as the immunogen.SHC antibody
The SHC antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets tyrosine residues and plays a crucial role in signal transduction pathways. The SHC antibody is known to interact with various proteins, including TNF-related apoptosis-inducing ligand (TRAIL), protein kinases, phosphatases, and fibrinogen. This antibody has been extensively studied for its potential therapeutic applications, such as in the development of targeted cancer therapies. It has also been used in the study of angiogenesis and microvessel density, as well as growth factor signaling pathways. Researchers rely on the high specificity and sensitivity of the SHC antibody to gain insights into complex cellular processes and advance scientific understanding.MTHFS antibody
MTHFS antibody was raised using a synthetic peptide corresponding to a region with amino acids TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY
FBXO42 antibody
FBXO42 antibody was raised using the middle region of FBXO42 corresponding to a region with amino acids RSMDEAPCVNGRWGTLRPRAQRQTPSGSREGSLSPARGDGSPILNGGSLSARP3 antibody
The ARP3 antibody is a highly specialized monoclonal antibody that targets extracellular histones. Histones play a crucial role in regulating gene expression through acetylation and other modifications. This antibody specifically binds to histones, inhibiting their activity and preventing them from interacting with other cellular components.
DHX9 antibody
DHX9 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKACAD10 antibody
The ACAD10 antibody is a highly specialized product in the field of Life Sciences. It serves as a serum marker and biochemical tool for various research applications, particularly in the study of pluripotent stem cells. This antibody specifically targets mesothelin, a glycoprotein that plays a crucial role in cell signaling and differentiation.
Myeloperoxidase antibody
Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.PTS antibody
The PTS antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target specific proteins and molecules involved in various biological processes. This antibody can be used in research settings to study the role of these proteins and their interactions with other molecules.LYSMD1 antibody
LYSMD1 antibody was raised using the N terminal of LYSMD1 corresponding to a region with amino acids VRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTNDSIFLKKTLYI14-3-3 theta antibody
The 14-3-3 theta antibody is an essential tool in Life Sciences research. It is a high-quality antibody that specifically targets the 14-3-3 theta protein. This protein plays a crucial role in various cellular processes, including signal transduction, cell cycle regulation, and apoptosis.CDC5L antibody
CDC5L antibody was raised in mouse using recombinant Human Cdc5 Cell Division Cycle 5-Like (S. Pombe) (Cdc5L)PEX5 antibody
The PEX5 antibody is a monoclonal antibody that has been specifically designed to target and neutralize the activity of PEX5, a protein involved in various cellular processes. This antibody is activated and reactive, making it highly effective in inhibiting the function of PEX5.MIA antibody
The MIA antibody is a polyclonal antibody that specifically targets annexin A2. It is widely used in the field of Life Sciences for various applications, including research and diagnostics. The MIA antibody has shown high affinity and specificity towards its target, making it a valuable tool in studying the role of annexin A2 in different biological processes.
COG4 antibody
COG4 antibody was raised using the middle region of COG4 corresponding to a region with amino acids LFSQGIGGEQAQAKFDSCLSDLAAVSNKFRDLLQEGLTELNSTAIKPQVQ
C1ORF43 antibody
C1ORF43 antibody was raised using the middle region of C1Orf43 corresponding to a region with amino acids YQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQFGF21 antibody
The FGF21 antibody is a cytotoxic monoclonal antibody that targets the surface glycoprotein and is used in immunoassays. It has been shown to have potential therapeutic applications in Life Sciences, particularly in the field of gluconeogenesis regulation. The FGF21 antibody can be used as a treatment option in combination with high-dose chemotherapy or multiagent chemotherapy, and it has also shown promise when combined with histone deacetylase inhibitors. Additionally, this antibody exhibits natriuretic and growth factor properties, making it a versatile tool in various research and clinical settings.
NR5A1 antibody
NR5A1 antibody was raised using the middle region of NR5A1 corresponding to a region with amino acids LQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWA
