Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
ELF5 antibody
The ELF5 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in studying neurotrophic factors and their effects on progesterone concentration and steroid metabolism. This antibody is specifically designed to target and bind to ELF5, a transcription factor involved in the regulation of various angiogenic factors such as arginase, angptl3, TGF-beta, and growth factor-2.
alpha Crystallin A antibody
alpha Crystallin A antibody was raised in mouse using recombinant human Crystallin alpha A (1-173aa) purified from E. coli as the immunogen.SHC antibody
The SHC antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets tyrosine residues and plays a crucial role in signal transduction pathways. The SHC antibody is known to interact with various proteins, including TNF-related apoptosis-inducing ligand (TRAIL), protein kinases, phosphatases, and fibrinogen. This antibody has been extensively studied for its potential therapeutic applications, such as in the development of targeted cancer therapies. It has also been used in the study of angiogenesis and microvessel density, as well as growth factor signaling pathways. Researchers rely on the high specificity and sensitivity of the SHC antibody to gain insights into complex cellular processes and advance scientific understanding.MTHFS antibody
MTHFS antibody was raised using a synthetic peptide corresponding to a region with amino acids TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY
FBXO42 antibody
FBXO42 antibody was raised using the middle region of FBXO42 corresponding to a region with amino acids RSMDEAPCVNGRWGTLRPRAQRQTPSGSREGSLSPARGDGSPILNGGSLSARP3 antibody
The ARP3 antibody is a highly specialized monoclonal antibody that targets extracellular histones. Histones play a crucial role in regulating gene expression through acetylation and other modifications. This antibody specifically binds to histones, inhibiting their activity and preventing them from interacting with other cellular components.
ND1 antibody
The ND1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the ND1 protein, which is involved in various cellular processes such as histidine metabolism, collagen synthesis, and lipoprotein lipase activity. This antibody can be used in experiments to study the function and regulation of ND1 protein.
DCK antibody
The DCK antibody is a recombinant antigen that has shown promising results in the field of Life Sciences. It is a monoclonal antibody that specifically targets arginase, an enzyme involved in various biological processes. This antibody has been extensively studied for its potential therapeutic applications in non-alcoholic steatohepatitis (NASH) and other related conditions.
LDL Receptor antibody
LDL receptor antibody was raised in mouse using purified bovine adreanal cortex LDL receptor as the immunogen.CD71 antibody
The CD71 antibody is a monoclonal antibody that targets the CD71 protein, also known as transferrin receptor 1. This protein plays a crucial role in the uptake of iron into cells and is involved in various cellular processes. The CD71 antibody has been extensively studied in the field of Life Sciences and has shown promising results in different applications.TWF1 antibody
TWF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVIGSYSQPSDSWDPTGER3 antibody
PTGER3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLER
Cyclin D1 antibody
The Cyclin D1 antibody is a powerful tool used in Life Sciences research. It is a Monoclonal Antibody that specifically targets Cyclin D1, a protein involved in cell cycle regulation. This antibody has been widely used for immunohistochemical detection of Cyclin D1 expression in various tissues and cell types.VPS28 antibody
VPS28 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQPRL antibody
The PRL antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to human serum alpha-fetoprotein, a growth factor involved in various physiological processes. This antibody has been extensively studied for its potential applications in immunosuppression and antiviral therapy. Additionally, the PRL antibody has shown promising results in interfering with interferon signaling pathways and modulating low-density lipoproteins. Its unique properties make it a valuable tool for researchers studying the role of growth factors and their implications in various diseases and conditions.Rat anti Mouse IgG1 Heavy Chain
Mouse IgG1 heavy chain antibody was raised in rat using murine IgG1 as the immunogen.MAP2B antibody
The MAP2B antibody is a growth factor that plays a crucial role in various biological processes. It is an essential tool in the field of Life Sciences for studying cellular functions and signaling pathways. This antibody specifically targets MAP2B, a protein involved in cytoskeleton organization and neuronal development.FAM113A antibody
FAM113A antibody was raised using the C terminal of FAM113A corresponding to a region with amino acids YPLPQPSPPPLFPPLPQDTPFFPGQPFPPHEFFNYNPVEDFSMPPHLGCGCathepsin C antibody
The Cathepsin C antibody is a neuroprotective monoclonal antibody that targets the glial fibrillary acidic protein (GFAP). It is commonly used in life sciences research to study the role of GFAP in various neurological disorders. This antibody has been shown to have neutralizing effects on the growth factor glucagon, which plays a crucial role in neuronal development and regeneration. The Cathepsin C antibody is also effective in detecting the presence of circumsporozoite protein, a marker for certain neurotrophic parasites. With its high specificity and sensitivity, this antibody is an invaluable tool for researchers studying neurodegenerative diseases and other related conditions.
Toxoplasma gondii p30 antibody
Toxoplasma gondii p30 antibody was raised in mouse using tachizoites lysate as the immunogen.TBG antibody
TBG antibody is a monoclonal antibody that specifically targets the chemokine androgen-independent. It acts as an agonist protein, mimicking the effects of the natural ligand. TBG antibody has been shown to bind to serum albumin protein and epidermal growth factor, activating their signaling pathways. Additionally, it has neutralizing properties against anti-ICOS antibodies, inhibiting their activity. This antibody is reactive and can be used for various applications in life sciences research, including the study of cell antigens and human serum. With its high specificity and neutralizing capabilities, TBG antibody is a valuable tool for researchers in the field.AGBL5 antibody
AGBL5 antibody was raised using the C terminal of AGBL5 corresponding to a region with amino acids NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLSFSHR antibody
The FSHR antibody is a polyclonal antibody used in Life Sciences research. It is specifically designed to target the follicle-stimulating hormone receptor (FSHR). This antibody is widely used in various applications, including Western blotting, immunohistochemistry, and flow cytometry.TOP2B antibody
The TOP2B antibody is a highly specialized product in the field of Life Sciences. It is designed to neutralize the activity of TOP2B, an enzyme involved in DNA replication and repair. This antibody can be used in various applications, including Western blotting, immunoprecipitation, and immunofluorescence. It has been shown to effectively inhibit the activity of TOP2B in nuclear extracts and interfere with its function. Additionally, this antibody has been found to enhance the effects of interferon and trastuzumab, an anti-HER2 antibody. Its unique properties make it a valuable tool for researchers studying epidermal growth factor signaling, androgen receptor function, and other growth factor pathways. The TOP2B antibody is available for purchase and comes with detailed instructions for use.
