Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
POMT1 antibody
POMT1 antibody was raised using the middle region of POMT1 corresponding to a region with amino acids LTFQILLLPVVLQHISDHLCRSQLQRSIFSALVVAWYSSACHVSNTLRPLPurity:Min. 95%CRABP1 antibody
CRABP1 antibody was raised in mouse using recombinant human CRABP1 (1-137aa) purified from E. coli as the immunogen.ZCCHC13 antibody
ZCCHC13 antibody was raised using the middle region of ZCCHC13 corresponding to a region with amino acids GKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMSEXO1 antibody
The EXO1 antibody is a highly specific and sensitive polyclonal antibody used in the field of Life Sciences. It is widely recognized for its ability to detect and target a variety of proteins, making it an essential tool in many research applications. This antibody has been extensively tested and validated, ensuring reliable and accurate results.
TNF alpha antibody
The TNF alpha antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and neutralizes tumor necrosis factor-alpha (TNF-α), a key player in inflammation and immune response. By binding to TNF-α, this antibody inhibits its activity, preventing it from interacting with its receptors and triggering inflammatory responses.LDB3 antibody
LDB3 antibody was raised using the N terminal of LDB3 corresponding to a region with amino acids PVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRPTFSPAFSRPSHemoglobin antibody
The Hemoglobin antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and binds to hemoglobin, a protein found in red blood cells that carries oxygen throughout the body. By binding to hemoglobin, this antibody can be used to study its function and regulation.PKN1 antibody
The PKN1 antibody is a cell proliferation inhibitory agent that belongs to the group of Polyclonal Antibodies. It has been shown to inhibit the growth of lymphocytic choriomeningitis by blocking the action of chemokines. This antibody can be used in vitro assays to study the effects of PKN1 on cell proliferation and migration. The PKN1 antibody is available as a monoclonal antibody, which means it specifically targets and neutralizes the PKN1 protein. It can be delivered using various methods, including the emulsion-solvent evaporation method. In addition to its cell growth inhibitory properties, this antibody also exhibits an antiangiogenic effect by blocking the growth of blood vessels. The PKN1 antibody is widely used in research laboratories and life sciences industries for its potential as a therapeutic medicament.PRKAR1A antibody
PRKAR1A antibody was raised in mouse using recombinant Human Protein Kinase, Camp-Dependent, Regulatory, Type I, Alpha (Tissue Specific Extinguisher 1) (Prkar1A)NOVA2 antibody
NOVA2 antibody was raised using the middle region of NOVA2 corresponding to a region with amino acids EPEQVHKAVSAIVQKVQEDPQSSSCLNISYANVAGPVANSNPTGSPYASPATP6V0D2 antibody
ATP6V0D2 antibody was raised using the middle region of ATP6V0D2 corresponding to a region with amino acids MNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPISTAT5B antibody
STAT5B antibody is an essential tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets STAT5B, a protein involved in various cellular processes such as cell growth, differentiation, and survival. This antibody is widely used in research to study the role of STAT5B in angiogenesis, neurotrophic factors, and growth factor signaling pathways.
CD3 antibody (Azide Free)
CD3 antibody (Azide free0 was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.CD80 antibody
The CD80 antibody is a highly targeted molecule that has shown promising results in combating Cryptosporidium, a parasite that causes severe gastrointestinal infections. This monoclonal antibody specifically binds to CD80, a protein found on the surface of immune cells, and inhibits its function. By doing so, it prevents the parasite from evading the immune system and replicating.ORF3 antibody
The ORF3 antibody is a highly specific monoclonal antibody that targets the epidermal growth factor receptor (EGFR), a tyrosine kinase receptor involved in various cellular processes. This antibody is widely used in Life Sciences research to study the function and regulation of EGFR.CYP2C9 antibody
The CYP2C9 antibody is a highly specialized product used in Life Sciences research. It is an essential tool for studying the role of the CYP2C9 enzyme in various biological processes. This monoclonal antibody is specifically designed to target and bind to the CYP2C9 protein, allowing researchers to detect and analyze its expression levels.TCR beta antibody
The TCR beta antibody is a reactive monoclonal antibody that specifically targets the T-cell receptor beta chain. This antibody has been extensively characterized and validated for its specificity and high affinity binding to the TCR beta chain. It can be used in various life science research applications, including flow cytometry, immunohistochemistry, and western blotting.EXOSC3 antibody
EXOSC3 antibody was raised using the C terminal of EXOSC3 corresponding to a region with amino acids VIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQAISSRLGNL3L antibody
GNL3L antibody was raised using a synthetic peptide corresponding to a region with amino acids MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPN
HNRPLL antibody
HNRPLL antibody was raised using the N terminal of HNRPLL corresponding to a region with amino acids MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGGVEGFA antibody
The VEGFA antibody is a glycopeptide that belongs to the class of monoclonal antibodies. It is designed to target and neutralize vascular endothelial growth factor A (VEGFA), which plays a crucial role in angiogenesis and tumor growth. By binding to VEGFA, this antibody inhibits its activity and prevents the formation of new blood vessels, thereby suppressing tumor growth. Additionally, the VEGFA antibody has been shown to interfere with cholinergic signaling and modulate immune responses by affecting the production of interferon, interleukin-6, and other cytokines. This antibody is widely used in life sciences research for studying angiogenesis, cancer biology, and autoimmune diseases. With its high specificity and potency, the VEGFA antibody is an invaluable tool for researchers looking to understand and manipulate cellular processes involving VEGFA.Apelin Receptor antibody
Apelin Receptor antibody is a monoclonal antibody that specifically targets the apelin receptor, a G-protein coupled receptor involved in various physiological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to alpha-fetoprotein, acidic androgen protein, autoantibodies, lysozyme, leukemia inhibitory factor, glycosylation, arginase, and other related factors. The Apelin Receptor antibody is widely used as a research tool for studying the role of apelin signaling pathways and its potential therapeutic applications. With its high specificity and inhibitory effects on apelin receptor activation, this antibody offers valuable insights into understanding the complex mechanisms underlying various biological processes.
cMyc antibody
The cMyc antibody is a powerful tool in the field of Life Sciences. It belongs to the group of Polyclonal Antibodies and monoclonal antibodies that specifically target the c-Myc protein complex. This antibody has the ability to neutralize the activity of c-Myc, a transcription factor that plays a crucial role in cell growth and proliferation.PPIL3 antibody
PPIL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGVQWRDLGSLQPPPPGFKQVFCLSLPRTGRGGNSIWGKKFEDEYSEYLK
PKCB antibody
PKCB antibody is an antibody that specifically targets protein kinase C beta (PKCB), an enzyme involved in various cellular processes. It is widely used in life sciences research to study the function and regulation of PKCB. This antibody can be used in immunohistochemistry, western blotting, and other techniques to detect and quantify the expression levels of PKCB in different tissues and cell types. It has been shown to have high specificity and sensitivity, making it a valuable tool for researchers studying signal transduction pathways, cell growth, differentiation, and apoptosis. Additionally, PKCB antibody has potential applications in therapeutic development, as targeting PKCB may have implications in diseases such as cancer and diabetes.
