Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
TRIB2 antibody
The TRIB2 antibody is a monoclonal antibody that is commonly used in Life Sciences research. It specifically targets the TRIB2 protein, which plays a crucial role in various cellular processes such as growth factor signaling and cell proliferation. This antibody has been extensively validated for applications such as immunohistochemistry, western blotting, and flow cytometry.PSCA antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, thereby inhibiting bacterial growth. Its effectiveness has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. The active form of this drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
WNT3 antibody
The WNT3 antibody is a growth factor medicament that is used in biochemical research and Life Sciences. It is a monoclonal antibody that specifically targets and binds to the activated form of WNT3, a crucial signaling molecule involved in various cellular processes. This antibody is commonly used in experiments to study the role of WNT3 in development, tissue regeneration, and disease progression.MYBL2 antibody
MYBL2 antibody was raised in mouse using recombinant V-Myb Myeloblastosis Viral Oncogene Homolog (Avian)-Like 2 (Mybl2)TNFR2 antibody
TNFR2 antibody is a monoclonal antibody that specifically targets the tumor necrosis factor receptor 2 (TNFR2). It has been widely used in life sciences research to study the role of TNFR2 in various biological processes. This antibody binds to the amino-terminal region of TNFR2 and can be used for various applications, including immunohistochemistry, flow cytometry, and Western blotting. TNFR2 antibody has been shown to have inhibitory effects on the activation of cardiomyocytes and the production of chemokines. It can also neutralize the activity of TNF-α, a pro-inflammatory cytokine. Additionally, this antibody has been used in studies investigating the natriuretic and anti-apoptotic effects of TNFR2 signaling. With its high specificity and affinity, TNFR2 antibody is a valuable tool for researchers studying TNFR2-related pathways and functions.FOXN2 antibody
FOXN2 antibody is a highly specific monoclonal antibody that targets the tyrosine kinase receptor FOXN2. This nuclear growth factor plays a crucial role in various cellular processes, including collagen synthesis and cell proliferation. The FOXN2 antibody is widely used in Life Sciences research to study the signaling pathways regulated by this receptor.CBR1 antibody
The CBR1 antibody is a neuroprotective agent that binds to specific proteins in the body. It acts by neutralizing certain inhibitors and promoting the health of nerve cells. This antibody is widely used in Life Sciences research and has been developed as a monoclonal antibody. It can be used in various applications, such as electrode-based assays or interferon detection. The CBR1 antibody has also shown promising results in studies involving human serum and mesenchymal stem cells. Its multidrug binding capabilities make it a valuable tool for researchers working with antibodies.alpha 2 Antiplasmin antibody (HRP)
alpha 2 Antiplasmin antibody (HRP) was raised in goat using human alpha 2 Antiplasmin purified from plasma as the immunogen.TRAF1 antibody
The TRAF1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets the tumor necrosis factor receptor-associated factor 1 (TRAF1), which plays a crucial role in various cellular processes, including insulin and epidermal growth factor signaling pathways. This antibody can be used for research purposes to study the function and regulation of TRAF1.Smad2 antibody
The Smad2 antibody is a highly specialized product in the field of Life Sciences. It is designed to specifically target and bind to activated Smad2, a key protein involved in cardiomyocyte function. This antibody can be used in various research applications, including the study of cardiac development, signaling pathways, and disease mechanisms.SYT13 antibody
The SYT13 antibody is an essential tool in Life Sciences research. It is an antibody that specifically targets and binds to SYT13, a glycoprotein involved in various cellular processes. This antibody has been extensively tested and characterized for its specificity, sensitivity, and neutralizing properties.CYP3A7 antibody
CYP3A7 antibody was raised using the middle region of CYP3A7 corresponding to a region with amino acids KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSIFGF21 antibody
The FGF21 antibody is a monoclonal antibody that specifically targets and binds to fibroblast growth factor 21 (FGF21). FGF21 is a growth factor that plays a crucial role in regulating various metabolic processes, including glucose and lipid metabolism. The FGF21 antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to metabolic disorders.UBE4B antibody
UBE4B antibody was raised using a synthetic peptide corresponding to a region with amino acids SPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQLBAIAP2L2 antibody
The BAIAP2L2 antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets the β-catenin protein, which plays a crucial role in cell growth and development. This antibody can be used to study the interactions between β-catenin and other growth factors, such as alpha-synuclein and epidermal growth factor.TWIST1 antibody
The TWIST1 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is commonly employed in various research applications such as polymerase chain reactions, monoclonal antibody assays, and formation assays. This antibody plays a crucial role in studying the interaction between cyclin D1/CDK4 and inhibitor p21, which are key proteins involved in cell cycle regulation. Additionally, the TWIST1 antibody can be utilized in DNA vaccine studies and hybridization experiments to investigate cyclin D2 expression and cyclin-dependent kinase activity. Researchers also employ this antibody to test substances for their potential impact on hepatic steatosis (fatty liver disease). With its high specificity and reliability, the TWIST1 antibody is an essential tool for scientists exploring molecular mechanisms and cellular processes related to cancer, development, and other areas of biomedical research.
Cytokeratin 16 antibody
The Cytokeratin 16 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets cytokeratin 16, an intermediate filament protein found in various epithelial tissues. This antibody has been extensively studied and proven to be effective in detecting and quantifying cytokeratin 16 expression.SERPINB5 antibody
SERPINB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM
