Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
KIR2DS4 antibody
KIR2DS4 antibody was raised in mouse using recombinant human kIR2DS4 purified from E. coli as the immunogen.Complement C9 antibody
Complement C9 antibody is a basic protein that belongs to the Life Sciences category. It is a monoclonal antibody that specifically targets complement component C9, which is involved in the formation of the membrane attack complex (MAC) during the complement cascade. This antibody binds to C9 and prevents its interaction with other complement components, thereby inhibiting MAC formation. Additionally, it has been shown to bind to other biomolecules such as collagen, myelin-associated glycoprotein, galectin-3, interferon, and various glycoproteins. The Complement C9 antibody can be used in research and diagnostic applications to study complement-mediated immune responses and investigate the role of C9 in disease pathology. Its high specificity and affinity make it an excellent tool for studying this important biomolecule.SIRT7 antibody
The SIRT7 antibody is a cholinergic monoclonal antibody that targets the adeno-associated virus. It is commonly used in Life Sciences for bioassays and research purposes. This antibody specifically recognizes and binds to β-catenin, a protein involved in cell adhesion and signaling pathways. By binding to β-catenin, the SIRT7 antibody prevents its interaction with other proteins, inhibiting the formation of dimers and interfering with its acetyltransferase activity. Additionally, this antibody has been shown to inhibit the growth factor-β1 signaling pathway, which plays a crucial role in cell proliferation and differentiation. The SIRT7 antibody can be utilized in various applications such as polymerase chain reactions (PCR), particle chemiluminescence assays, and as a cytotoxic formation inhibitor. It is available as both a monoclonal and polyclonal antibody, providing researchers with options to suit their specific needs.PDSS2 antibody
PDSS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFSANT2 antibody
The ANT2 antibody is a highly activated nuclear antibody that has been developed as an inhibitor for various immunoassays. It specifically targets neurotrophic factors and can be used as a monoclonal antibody in research and diagnostic applications. Additionally, the ANT2 antibody has shown inhibitory properties against TGF-β1, chemokines, and TNF-α. Its neutralizing capabilities make it a valuable tool for studying the effects of these factors on cellular processes. With its immobilization potential and anti-CD33 antibody properties, the ANT2 antibody offers researchers a versatile option for their experiments.KLHL23 antibody
KLHL23 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYDKVQSYNSDINEWSLITSSPHPEYGLCSVPFENKLYLVGGQTTITECYApoD antibody
The ApoD antibody is a monoclonal antibody that specifically targets a protein found in human serum. It is widely used in Life Sciences research to study various biological processes. One of its key applications is the detection and analysis of amyloid plaques, which are associated with neurodegenerative diseases such as Alzheimer's disease. The ApoD antibody has also been used to study hormone peptides, including glucagon, and chemokines. Additionally, it has shown promise in cancer research, particularly in the study of breast cancer cells (such as MCF-7 cells). This highly specific antibody binds to its target protein with high affinity, making it a valuable tool for researchers in various fields.PTK7 antibody
PTK7 antibody was raised in Mouse using a purified recombinant fragment of human PTK7 expressed in E. coli as the immunogen.CDC42 antibody
The CDC42 antibody is a monoclonal antibody that has the ability to neutralize the influenza hemagglutinin. It belongs to the group of antibodies known as monoclonal antibodies, which are highly specific and targeted against a particular antigen. This antibody can be used in various applications, including diagnostic tests and research studies.LYK5 antibody
LYK5 antibody was raised using the N terminal of LYK5 corresponding to a region with amino acids MSFLTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLMTVNLCopine IV antibody
Copine IV antibody was raised using the C terminal of CPNE4 corresponding to a region with amino acids EAYQSCLPKLQLYGPTNIAPIIQKVAKSASEETNTKEASQYFILLILTDGFoxp1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug that falls under the class of rifamycins. It is known to be the most potent rifamycin for treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth and prevents transcription and replication. Extensive research has shown its high activity on human erythrocytes using a patch-clamp technique. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.GATA1 antibody
The GATA1 antibody is a highly specialized product in the field of Life Sciences. It belongs to the class of monoclonal antibodies and is designed to target specific virus surface antigens. This antibody has been extensively tested and proven to effectively inhibit the growth and replication of viruses in human serum.
SOX6 antibody
SOX6 antibody was raised in mouse using recombinant Human Sry (Sex Determining Region Y)-Box 6 (Sox6),PHYHIP antibody
PHYHIP antibody was raised using the N terminal of PHYHIP corresponding to a region with amino acids KFKHRDVPTKLVAKAVPLPMTVRGHWFLSPRTEYSVAVQTAVKQSDGEYLPADI2 antibody
PADI2 antibody was raised using the middle region of PADI2 corresponding to a region with amino acids RGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYV
eNOS antibody
The eNOS antibody is a monoclonal antibody used in Life Sciences research. It specifically targets endothelial nitric oxide synthase (eNOS), an enzyme involved in the production of nitric oxide. This antibody is widely used to study the role of eNOS in various physiological processes, including lipoprotein lipase activity, antiviral responses, and growth factor signaling pathways. The eNOS antibody can be immobilized on electrodes or used in colloidal form for detection and quantification of eNOS in samples such as human serum. Additionally, this antibody has been shown to have neuroprotective effects and can modulate interferon signaling pathways. Its high specificity and ability to recognize different forms of eNOS due to glycosylation make it a valuable tool for researchers studying various cellular processes.XIAP antibody
The XIAP antibody is a hormone peptide that belongs to the class of antibodies. It specifically targets serum albumin, particularly human serum albumin, and acts as a neutralizing agent. This antibody has been extensively studied in the field of Life Sciences and has shown inhibitory effects on various growth factors, chemokines, and epinephrine-like molecules. The XIAP antibody is available in both polyclonal and monoclonal forms, making it suitable for different research applications. Its high specificity and affinity make it an essential tool for studying protein-protein interactions and signaling pathways. With its ability to block the activity of specific molecules, the XIAP antibody offers great potential for therapeutic interventions in various diseases.LOC728331 antibody
LOC728331 antibody was raised using the N terminal of LOC728331 corresponding to a region with amino acids AALGRTRAPNGATPRGEDGLSPTPTPGTDASGKGRGRPGKRGAPGGRADPDYNLL1 antibody
DYNLL1 antibody was raised using the middle region of DYNLL1 corresponding to a region with amino acids EKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILCaMK4 antibody
The CaMK4 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It belongs to the family of polyclonal antibodies and is widely used in life sciences research. This antibody specifically targets and binds to CaMK4, which stands for calcium/calmodulin-dependent protein kinase 4.MPST antibody
MPST antibody was raised using the middle region of MPST corresponding to a region with amino acids DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTCHK1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds with bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. Its active form undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
