Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75448 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Myxovirus antibody
Myxovirus antibody was raised using the C terminal of MX1 corresponding to a region with amino acids KAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPGPurity:Min. 95%MDFIC antibody
MDFIC antibody was raised in rabbit using the middle region of MDFIC as the immunogenPurity:Min. 95%Flt3 Ligand antibody
Flt3 Ligand antibody was raised using the N terminal of FLT3LG corresponding to a region with amino acids TVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYPurity:Min. 95%LGALSL antibody
1110067D22Rik antibody was raised in rabbit using the middle region of 1110067D22Rik as the immunogenPurity:Min. 95%ALG11 antibody
ALG11 antibody was raised using the C terminal of ALG11 corresponding to a region with amino acids LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAESPurity:Min. 95%ZNF664 antibody
ZNF664 antibody was raised in rabbit using the N terminal of ZNF664 as the immunogenPurity:Min. 95%Fzr1 antibody
Fzr1 antibody was raised in rabbit using the N terminal of Fzr1 as the immunogenPurity:Min. 95%CHST6 antibody
CHST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids QELCAGALQLLGYRPVYSEDEQRNLALDLVLPRGLNGFTWASSTASHPRNPurity:Min. 95%FGF11 antibody
FGF11 antibody was raised in rabbit using the N terminal of FGF11 as the immunogenPurity:Min. 95%BRCA2 antibody
The BRCA2 antibody is a highly specialized monoclonal antibody that targets the BRCA2 protein. This protein plays a crucial role in DNA repair and maintenance of genomic stability. The antibody specifically recognizes and binds to the BRCA2 protein, leading to its immobilization and subsequent degradation.Purity:Min. 95%Matriptase antibody
The Matriptase antibody is an immunomodulatory agent that plays a crucial role in regulating cell growth and development. It acts as a growth factor and interferon, helping to modulate immune responses and promote tissue repair. This monoclonal antibody specifically targets matriptase, an enzyme involved in various cellular processes.Purity:Min. 95%UGT2A3 antibody
UGT2A3 antibody was raised using the N terminal of UGT2A3 corresponding to a region with amino acids NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEENPurity:Min. 95%Clec1b antibody
Clec1b antibody was raised in rabbit using the N terminal of Clec1b as the immunogenPurity:Min. 95%Sntg1 antibody
Sntg1 antibody was raised in rabbit using the N terminal of Sntg1 as the immunogen
Purity:Min. 95%ZNF724P antibody
ZNF724P antibody was raised in rabbit using the N terminal of ZNF724P as the immunogenPurity:Min. 95%VPS29 antibody
VPS29 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGL
Purity:Min. 95%Cyclin B1 antibody
Cyclin B1 antibody was raised using the middle region of CCNB1 corresponding to a region with amino acids AKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKVPurity:Min. 95%ZXDC antibody
ZXDC antibody was raised in rabbit using the middle region of ZXDC as the immunogenPurity:Min. 95%ZNF286 antibody
ZNF286 antibody was raised in rabbit using the N terminal of ZNF286 as the immunogenPurity:Min. 95%TSLP antibody
TSLP antibody was raised in rabbit using highly pure recombinant human TSLP as the immunogen.Purity:Min. 95%CYP4F12 antibody
CYP4F12 antibody was raised using the middle region of CYP4F12 corresponding to a region with amino acids DGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDVPurity:Min. 95%Vamp1 antibody
Vamp1 antibody was raised in rabbit using the middle region of Vamp1 as the immunogenPurity:Min. 95%CHRNA3 antibody
CHRNA3 antibody was raised using the N terminal of CHRNA3 corresponding to a region with amino acids EHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNPurity:Min. 95%IL10 antibody
IL10 antibody was raised in rabbit using highly pure recombinant rat IL-10 as the immunogen.Purity:Min. 95%FNDC4 antibody
FNDC4 antibody was raised using the middle region of FNDC4 corresponding to a region with amino acids EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSPurity:Min. 95%SRD5A3 antibody
SRD5A3 antibody was raised using the N terminal of SRD5A3 corresponding to a region with amino acids GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWNPurity:Min. 95%DHODH antibody
DHODH antibody was raised using the C terminal of DHODH corresponding to a region with amino acids GGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASPurity:Min. 95%ACADVL antibody
ACADVL antibody was raised in rabbit using the C terminal of ACADVL as the immunogenPurity:Min. 95%KRAS antibody
KRAS antibody was raised using the N terminal of KRAS corresponding to a region with amino acids TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCPurity:Min. 95%PDE1A antibody
PDE1A antibody was raised in rabbit using the C terminal of PDE1A as the immunogen
Purity:Min. 95%IL1 beta antibody
IL1 beta antibody was raised using the N terminal of IL1B corresponding to a region with amino acids MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLPurity:Min. 95%GRK1 antibody
GRK1 antibody was raised in rabbit using the middle region of GRK1 as the immunogenPurity:Min. 95%GPX3 antibody
GPX3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYIPurity:Min. 95%CTF1 antibody
CTF1 antibody was raised in rabbit using the N terminal of CTF1 as the immunogenPurity:Min. 95%Rnf122 antibody
Rnf122 antibody was raised in rabbit using the middle region of Rnf122 as the immunogenPurity:Min. 95%SLC35D3 antibody
SLC35D3 antibody was raised using the N terminal of SLC35D3 corresponding to a region with amino acids RYQFSFLTLVQCLTSSTAALSLELLRRLGLIAVPPFGLSLARSFAGVAVLPurity:Min. 95%TMEM166 antibody
TMEM166 antibody was raised using the N terminal Of Tmem166 corresponding to a region with amino acids RLPLSHSPEHVEMALLSNILAAYSFVSENPERAALYFVSGVCIGLVLTLAPurity:Min. 95%Klhl12 antibody
Klhl12 antibody was raised in rabbit using the N terminal of Klhl12 as the immunogenPurity:Min. 95%ZNHIT1 antibody
ZNHIT1 antibody was raised in rabbit using the N terminal of ZNHIT1 as the immunogen
Purity:Min. 95%KIAA1604 antibody
KIAA1604 antibody was raised in rabbit using the C terminal of KIAA1604 as the immunogenPurity:Min. 95%UBE2K antibody
UBE2K antibody was raised in rabbit using the N terminal of UBE2K as the immunogen
Purity:Min. 95%SOHLH2 antibody
SOHLH2 antibody was raised in rabbit using the middle region of SOHLH2 as the immunogen
Purity:Min. 95%TXNDC15 antibody
TXNDC15 antibody was raised using the C terminal of TXNDC15 corresponding to a region with amino acids STRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTGIEAKKNV
Purity:Min. 95%Aadacl1 antibody
Aadacl1 antibody was raised in rabbit using the middle region of Aadacl1 as the immunogenPurity:Min. 95%Ribophorin II antibody
Ribophorin II antibody was raised using the N terminal of RPN2 corresponding to a region with amino acids ASQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVAPurity:Min. 95%MGLL antibody
MGLL antibody was raised in rabbit using the N terminal of MGLL as the immunogenPurity:Min. 95%
