Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75448 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
ATP5B antibody
ATP5B antibody was raised using the N terminal of ATP5B corresponding to a region with amino acids PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQTSPAN12 antibody
The TSPAN12 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets TSPAN12, a glycoprotein found on the surface of human cells. This antibody has been extensively studied and shown to have cytotoxic effects on various cell types, including cardiomyocytes.
MST1R antibody
MST1R antibody was raised in Mouse using a purified recombinant fragment of human MST1R (aa210-320) expressed in E. coli as the immunogen.IGF2BP2 antibody
The IGF2BP2 antibody is a powerful tool used in the field of life sciences. It is a monoclonal antibody that has been extensively studied and characterized using mass spectrometric methods. This antibody plays a crucial role in various biological processes, including syncytia formation, growth factor signaling, and virus surface antigen activation.EDG6 antibody
The EDG6 antibody is a protein that acts as a phosphatase. It is a polyclonal antibody that is commonly used in the field of life sciences. This antibody specifically targets the hepatocyte growth factor, which plays a crucial role in cell growth and development. The EDG6 antibody can be used to detect and measure the levels of this growth factor in various biological samples. Additionally, this antibody has been shown to interact with other proteins such as fibrinogen, steroids, glycosylation enzymes, natriuretic peptides, mycoplasma genitalium, activated dopamine receptors, and growth factors. Its specificity and high affinity make it an essential tool for researchers studying these pathways. Order your EDG6 antibody today and unlock new insights into cellular signaling and protein interactions.RPGR antibody
The RPGR antibody is a powerful tool used in Life Sciences research. It targets the retinitis pigmentosa GTPase regulator (RPGR), a protein involved in various cellular processes, including adrenomedullin signaling and protein kinase activation. This antibody is commonly used for nuclear localization studies and can be utilized in a variety of applications, such as immunoassays and Western blotting. The RPGR antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options to suit their specific needs. With its high specificity and neutralizing activity, this antibody is an essential component in studying the role of RPGR in disease mechanisms and potential therapeutic interventions.C4ORF33 antibody
C4ORF33 antibody was raised using the C terminal Of C4Orf33 corresponding to a region with amino acids PNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFICA1 antibody
ICA1 antibody was raised using the C terminal of ICA1 corresponding to a region with amino acids NMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNAMMP14 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to treat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, effectively inhibiting transcription and replication processes. Additionally, this drug has been extensively tested using advanced techniques like patch-clamp on human erythrocytes, demonstrating its high efficacy in combating tuberculosis.FLAG Antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture. Tilmicosin is a macrolide antibiotic widely used in veterinary medicine for respiratory disorders caused by bacteria such as Clostridium perfringens. Its mechanism of actionC18ORF25 antibody
C18ORF25 antibody was raised using the middle region of C18Orf25 corresponding to a region with amino acids STSSSDDDEEVSGSSKTITAEIPGHLDPGFLASDKTSAGNAPLNEEINIA
MMP3 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied using a patch-clamp technique on human erythrocytes, confirming its high activity. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.IKB alpha antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. The active form of this drug has been extensively studied using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture.NUDT18 antibody
NUDT18 antibody was raised using a synthetic peptide corresponding to a region with amino acids KGLLGLQHLGRDHSDGICLNVLVTVAFRSPGIQDEPPKVRGENFSWWKVM
PfHRPII antibody
The PfHRPII antibody is a growth factor that promotes endothelial growth and fatty acid metabolism. It targets annexin A2, an important protein involved in cell signaling and membrane organization. This monoclonal antibody has been extensively studied and shown to have therapeutic potential in various diseases, including cancer. It has been found to inhibit the growth of MCF-7 breast cancer cells and enhance the activity of erythropoietin, a hormone that stimulates red blood cell production. Additionally, this antibody has low density and high specificity for its target, making it an ideal tool for research and diagnostics. Its unique properties make it a valuable asset in studying the role of growth factors, epidermal growth factor (EGF), transforming growth factor-beta (TGF-beta), basic proteins, and annexins in cellular processes. With its exceptional performance and reliability, this PfHRPII antibody is an essential component for any laboratory or research facility seeking to advance their understanding of cell biology.PRDM1 antibody
PRDM1 antibody was raised in Mouse using a purified recombinant fragment of human PRDM1 expressed in E. coli as the immunogen.Thrombomodulin antibody
Thrombomodulin antibody is a monoclonal antibody that specifically targets thrombomodulin, an extracellular protein involved in blood coagulation and inflammation. This antibody has cytotoxic effects on cells expressing alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's disease. It has been shown to reduce microvessel density and inhibit the formation of actin filaments in vitro. Thrombomodulin antibody can be used in life sciences research to study the role of thrombomodulin in various biological processes and as a potential therapeutic agent for conditions involving abnormal blood clotting or inflammation.IFRD1 antibody
IFRD1 antibody was raised using the middle region of IFRD1 corresponding to a region with amino acids LALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVF
LHX2 antibody
The LHX2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It acts as a neutralizing agent against a specific antigen, targeting low-density lipoprotein (LDL) receptors. This soluble antibody binds to LDL receptors and prevents the uptake of LDL particles into cells. By blocking this process, it helps researchers study the role of LDL receptors in various biological processes.SSB antibody
The SSB antibody is a specific antibody that belongs to the class of monoclonal antibodies. It has neutralizing properties and can be used in various applications in the field of Life Sciences. This antibody is commonly used in research to study the function of SSB (single-stranded DNA-binding protein) and its role in various biological processes.LMO1 antibody
LMO1 antibody was raised in mouse using recombinant Human Lim Domain Only 1 (Rhombotin 1)TRPM5 antibody
TRPM5 antibody was raised using the N terminal of TRPM5 corresponding to a region with amino acids AAPWLILVGSGGIADVLAALVNQPHLLVPKVAEKQFKEKFPSKHFSWEDICPEB2 antibody
CPEB2 antibody was raised using the N terminal of CPEB2 corresponding to a region with amino acids FLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMGArginase 1 antibody
The Arginase 1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets arginase, an enzyme involved in the metabolism of arginine. This antibody can be used for various applications, including immunohistochemistry, western blotting, and ELISA.SSX1 antibody
The SSX1 antibody is a highly specialized monoclonal antibody used in the field of life sciences. It targets and binds to the activated form of SSX1, a methyl transferase enzyme involved in various cellular processes. This antibody is designed to specifically recognize and bind to the phosphorylation site on SSX1, allowing for precise detection and analysis.
Goat anti Armenian Hamster IgG (H + L) (FITC)
Goat anti-armenian hamster IgG (H + L) (FITC) was raised in goat using hamster IgG (H & L) as the immunogen.
