Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
SLC25A46 antibody
SLC25A46 antibody was raised using the N terminal of SLC25A46 corresponding to a region with amino acids RSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEPGPR56 antibody
The GPR56 antibody is a highly specialized protein complex that plays a crucial role in various biological processes. It acts as a growth factor, regulating cell growth and development. This antibody is known for its viscosity properties, allowing it to bind tightly to its target molecules.GLO1 antibody
The GLO1 antibody is a highly specific monoclonal antibody used in life sciences research. It targets the carboxy terminal of the human enzyme glyoxalase 1 (GLO1), which is a serum marker and has been associated with various diseases. This antibody is designed to detect autoantibodies against GLO1, allowing for the exploration of their role in disease development and progression. The GLO1 antibody has been extensively validated and is suitable for use in various applications, including immunohistochemical detection. Its high affinity and specificity ensure accurate and reliable results. With its spherical morphology and tetramerization domain, this monoclonal antibody provides excellent binding to the target protein, making it an invaluable tool for researchers in the field of life sciences.
DGKA antibody
The DGKA antibody is a mouse monoclonal antibody that specifically targets opioid peptides. This antibody has been developed for use in various research applications within the Life Sciences field. It has been shown to form stable complexes with phenyl phosphate and exhibit chemotactic activity. The DGKA antibody is highly specific, making it an ideal tool for studying steroid metabolites and androgen biosynthesis. With its ability to form hydrogen bonds, this monoclonal antibody provides valuable insights into the complex mechanisms of opioid peptide signaling. Researchers can rely on the DGKA antibody to enhance their understanding of these important biological processes.Histone H3 antibody
The Histone H3 antibody is a specific antibody that targets the nuclear β-catenin, which plays a crucial role in various cellular processes. This antibody has been shown to interact with other proteins such as leukemia inhibitory factor and interleukin-6, indicating its involvement in growth factor signaling pathways. Additionally, the Histone H3 antibody has been found to modulate cholinergic and dopamine neurotransmission, suggesting its potential impact on neurological functions.KRAS antibody
The KRAS antibody is a highly specialized diagnostic agent used in the field of molecular biology and medical research. This antibody specifically targets KRAS, a protein that plays a crucial role in cell signaling and growth regulation. By binding to KRAS, this antibody can help researchers understand the function and activity of this protein.Dengue NS1 antibody (Subtype 1)
Mouse monoclonal Dengue NS1 antibody (Subtype 1); Supplied in PBS buffer with sodium azide
OCT4 antibody
OCT4 antibody was raised in Mouse using synthesized peptide derived from internal of human POU5F1 as the immunogen.ERBB2 antibody
ERBB2 antibody was raised in Mouse using a purified recombinant fragment of human ERBB2 (aa750-987) expressed in E. coli as the immunogen.
TOR2A antibody
TOR2A antibody was raised using the N terminal of TOR2A corresponding to a region with amino acids GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKSSPAG4L antibody
SPAG4L antibody was raised using the N terminal of SPAG4L corresponding to a region with amino acids MPRSSRSPGDPGALLEDVAHNPRPRRIAQRGRNTSRMAEDTSPNMNDNILbeta Tubulin antibody
The beta Tubulin antibody is a highly specialized antibody that targets the beta tubulin protein. This protein plays a crucial role in cell division and is essential for the formation of microtubules, which are involved in various cellular processes. The beta Tubulin antibody has been extensively studied and proven to be effective in detecting and quantifying beta tubulin in various biological samples.
Cytokeratin 1 antibody
Cytokeratin 1 antibody was raised in mouse using human epidermal keratin as the immunogen.CSTF3 antibody
CSTF3 antibody was raised using the middle region of CSTF3 corresponding to a region with amino acids FEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSK
CD31 antibody
The CD31 antibody is a monoclonal antibody that is commonly used in life sciences research. It is designed to specifically bind to CD31, a protein that is expressed on the surface of activated tyrosine kinase receptors. This antibody can be used in various assays and experiments to study the function and activity of these receptors.OR2B2 antibody
OR2B2 antibody was raised in rabbit using the C terminal of OR2B2 as the immunogenPurity:Min. 95%E2F4 antibody
The E2F4 antibody is a highly specialized protein molecule drug used in Life Sciences. It belongs to the class of monoclonal antibodies and possesses neutralizing properties. This antibody specifically targets E2F4, a protein involved in cell cycle regulation and DNA replication. By binding to E2F4, this antibody prevents its activity and inhibits cell division.
