Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Caspase 1 antibody
The Caspase 1 antibody is a highly effective globulin that acts as a neutralizing agent against caspase 1. This monoclonal antibody has been specifically developed to target and inhibit the activity of caspase 1, an enzyme involved in inflammatory responses. By binding to caspase 1, this antibody blocks its function and prevents the release of pro-inflammatory cytokines.FAS ligand antibody
The FAS ligand antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets the FAS ligand, a protein involved in various cellular processes such as collagen production, dopamine regulation, erythropoietin synthesis, and fibrinogen formation. By binding to the FAS ligand, this antibody effectively inhibits its function and disrupts downstream signaling pathways.p16 antibody
p16 antibody was raised in Mouse using a purified recombinant fragment of P16 expressed in E. coli as the immunogen.PGD antibody
The PGD antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to alpha-fetoprotein, a protein that is associated with various diseases and conditions. The PGD antibody has been extensively tested and proven to be highly specific and sensitive in detecting alpha-fetoprotein in human serum samples. It can be used for various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. The PGD antibody can also be conjugated with different markers or enzymes for enhanced detection and visualization. With its high affinity and cytotoxic properties, the PGD antibody holds great potential for targeted therapy in the future.
SOCS3 antibody
The SOCS3 antibody is a biomaterial protein that plays a crucial role in various biological processes. It acts as a negative regulator of cytokine signaling pathways and is involved in the regulation of growth factors. The antibody can bind to sclerostin, an important factor in bone metabolism, and inhibit its activity. Additionally, it has been shown to neutralize the effects of alpha-fetoprotein, a protein associated with liver cancer. The SOCS3 antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs. Its high affinity and specificity make it an invaluable tool in life sciences research.
ZHX2 antibody
The ZHX2 antibody is a protein reagent used in Life Sciences research. It is a polyclonal antibody that specifically targets and inhibits cytokines. This antibody is widely used in various experiments and studies to investigate the role of cytokines in different biological processes. With its high specificity and potency, the ZHX2 antibody is an essential tool for researchers in the field of immunology and molecular biology. Whether you are studying immune responses, inflammation, or cell signaling pathways, this antibody can provide valuable insights into the mechanisms underlying these processes. Trust the ZHX2 antibody to deliver reliable results and contribute to advancements in scientific knowledge.
SFRS8 antibody
SFRS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVFGYACKLFRDDERALAQEQGQHLIPWMGDHKILIDRYDGRGHLHDLSECartilage associated protein antibody
Affinity purified Rabbit polyclonal Cartilage associated protein antibody
C16ORF46 antibody
C16ORF46 antibody was raised using the N terminal Of C16Orf46 corresponding to a region with amino acids LSHWSLQTKPPTEGGPEKDQSSPSQTQAAPQGPSTASRAISDICFPTYFRCCDC60 antibody
CCDC60 antibody was raised using the C terminal of CCDC60 corresponding to a region with amino acids RPAKKILVKLQKFGENLDLRIRPHVLLKVLQDLRIWELCSPDIAVAIEFVKeratin 14 antibody
The Keratin 14 antibody is a highly specialized antibody that is used in various solid phase assays. It can be used for antibody-drug conjugation, making it a valuable tool in the field of Life Sciences. This antibody specifically targets and binds to keratin 14, a protein involved in the structure and function of epithelial cells.Donkey anti Human IgG (H + L) (FITC)
Donkey anti-human IgG (H + L) (FITC) was raised in donkey using human IgG (H&L) as the immunogen.EFHA2 antibody
EFHA2 antibody was raised using the N terminal of EFHA2 corresponding to a region with amino acids AAAGGGLVGLVCYQLYGDPRAGSPATGRPSKSAATEPEDPPRGRGMLPIP
MRC2 antibody
The MRC2 antibody is a highly specific monoclonal antibody that targets the MRC2 protein. This protein is involved in various cellular processes, including insulin signaling, collagen metabolism, and cell adhesion. The MRC2 antibody has been extensively studied and has shown great potential in research and diagnostic applications.
