Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
G16 antibody
The G16 antibody is a highly specialized antibody that targets glycoproteins and acts as an anti-connexin agent. This monoclonal antibody is widely used in Life Sciences research, particularly in studies involving estrogen receptors. It has been proven to effectively prevent denaturation of these receptors and inhibit their biochemical activity. Additionally, the G16 antibody can be used for hormone peptide recombination and has shown neutralizing properties against certain hormones. Its glycopeptide structure makes it highly specific and effective in various applications, including neuroprotective research.VEGF antibody (biotin)
VEGF antibody (biotin) was raised in rabbit using highly pure recombinant murine VEGF as the immunogen.AWAT1 antibody
AWAT1 antibody was raised using the N terminal of AWAT1 corresponding to a region with amino acids NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEAPurity:Min. 95%ALOX15B antibody
ALOX15B antibody was raised using the middle region of ALOX15B corresponding to a region with amino acids CHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQTNVIPurity:Min. 95%Survivin antibody
The Survivin antibody is a colloidal polyclonal antibody that is used in the field of Life Sciences. It acts as an inhibitor of tumor necrosis factor-alpha (TNF-α) and plays a crucial role in regulating cell division and apoptosis. This antibody specifically targets survivin, a protein that belongs to the inhibitor of apoptosis (IAP) family. By neutralizing survivin, this antibody prevents its interaction with other proteins involved in cell survival and growth, such as hepatocyte growth factor and epidermal growth factor. Additionally, the Survivin antibody has been shown to have cytotoxic effects on cancer cells by inhibiting their proliferation and inducing cell death. This makes it a valuable tool for researchers studying various diseases and exploring potential therapeutic strategies.CSP antibody
The CSP antibody is a highly specialized antibody that targets collagen, a protein found in various tissues of the body. It is particularly effective against Mycoplasma genitalium, a bacterium that causes infections in the genital tract. This polyclonal antibody has chemokine-like properties, meaning it can attract immune cells to the site of infection and enhance their response. Additionally, it has neutralizing abilities against certain growth factors such as TGF-beta and TNF-α, which are involved in inflammation and tissue remodeling. The CSP antibody can also bind to epidermal growth factor (EGF) and disrupt its interaction with its receptor, thus inhibiting cell proliferation. This makes it a valuable tool in research and therapeutic applications targeting diseases involving abnormal collagen metabolism or excessive growth factor signaling pathways.CD80 antibody
The CD80 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets CD80, a protein involved in immune responses and cell signaling. This antibody can be used in various applications such as immunohistochemistry, flow cytometry, and Western blotting.Rat Pan Granulocytes antibody
Rat pan granulocytes antibody was raised in mouse using peritoneal cells as the immunogen.TIMP1 antibody
The TIMP1 antibody is a cytotoxic protein that plays a crucial role in various Life Sciences applications. It is a growth factor that regulates cell proliferation and differentiation. The TIMP1 antibody is widely used in chromatographic techniques, as well as in the development of monoclonal antibodies. It specifically targets hepatocyte growth factor, epidermal growth factor, collagen, and other binding proteins. This antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific experimental needs. With its high specificity and affinity, the TIMP1 antibody is an invaluable tool for studying cellular processes and identifying potential therapeutic targets.TRPC1 antibody
The TRPC1 antibody is a highly specialized polyclonal antibody that specifically targets and binds to the TRPC1 protein. This monoclonal antibody is designed to detect and measure the expression levels of TRPC1 in various biological samples. TRPC1 is a cation channel that plays a crucial role in numerous physiological processes, including hormone peptide signaling, growth factor regulation, and adipose tissue function. By utilizing this antibody, researchers in the field of Life Sciences can gain valuable insights into the activation and regulation of TRPC1 channels.RAB5A antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit strong bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The efficacy of this drug has been extensively tested using advanced techniques such as the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
TFEB antibody
The TFEB antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the transcription factor EB (TFEB), a protein involved in the regulation of various cellular processes. This antibody has been shown to be effective in detecting TFEB in different tissues and cell types, including adipose tissue. By binding to TFEB, this antibody can help researchers study its role in cellular processes such as autophagy, lysosomal biogenesis, and lipid metabolism.
PEF1 antibody
PEF1 antibody was raised using the middle region of PEF1 corresponding to a region with amino acids WKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRY
CARF antibody
CARF antibody was raised using the C terminal Of Carf corresponding to a region with amino acids AIEALKATLDVFFVPLKELADLPQNKSSQESIVCELRCKSVYLGTGCGKSPHGDH antibody
The PHGDH antibody is a highly specialized antibody used in the field of Life Sciences. It plays a crucial role in various biological processes, including growth factor signaling, caspase-9 activation, and interferon production. This antibody specifically targets and binds to the PHGDH protein, which is an enzyme involved in the biosynthesis of serine.HNRNPU antibody
HNRNPU antibody was raised using a synthetic peptide corresponding to a region with amino acids NGAAGAADSGPMEEEEAASEDENGDDQGFQEGEDELGDEEEGAGDENGHGISG20 antibody
ISG20 antibody was raised using the N terminal of ISG20 corresponding to a region with amino acids GAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLLKGKMLF1 antibody
MLF1 antibody was raised using the N terminal of MLF1 corresponding to a region with amino acids GRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQTUSC2 antibody
The TUSC2 antibody is a glycoprotein that plays a crucial role in various life sciences applications. It exhibits hydroxylase activity and acts as a medicament for targeted therapy. The TUSC2 antibody is commonly used in research and diagnostic laboratories to detect specific proteins or antigens of interest. It binds to the surface glycoprotein on cells, allowing for the identification and analysis of various cellular processes.EN1 antibody
EN1 antibody was raised using the C terminal of EN1 corresponding to a region with amino acids LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKZNF451 antibody
ZNF451 antibody was raised in rabbit using the C terminal of ZNF451 as the immunogenPurity:Min. 95%IL4 antibody
The IL4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and neutralizes interleukin-4 (IL-4), a glycan involved in various biological processes. This antibody has been extensively studied for its potential therapeutic applications.
NODAL antibody
NODAL antibody was raised using a synthetic peptide corresponding to a region with amino acids PSSPSPLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQ
LPL antibody
The LPL antibody is a powerful inhibitor used in the field of Life Sciences. It is specifically designed to target and neutralize the activity of lipoprotein lipase (LPL), an enzyme involved in lipid metabolism. This antibody has been extensively studied and proven to effectively block LPL function, making it a valuable tool for researchers studying the role of LPL in various biological processes.
