Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CD28 antibody
The CD28 antibody is a powerful tool used in scientific research and medical applications. It is an antibody that specifically targets the CD28 protein, which plays a crucial role in T-cell activation and immune response regulation.
PIWIL1 antibody
PIWIL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYYMRP2 antibody
The MRP2 antibody is a highly specific antigen that targets helicobacter and phosphorylcholine. It is a polyclonal antibody that can be used to detect and measure the levels of antibodies in various samples. This antibody has been extensively studied in the field of life sciences and has shown promising results in applications such as autoantibody detection, anti-connexin agent research, annexin binding studies, and substrate siRNA delivery. Additionally, the MRP2 antibody has been used in monoclonal antibody development for targeting macrophage inflammatory responses and chemokine signaling pathways. Its versatility and reliability make it an essential tool for researchers studying telomerase activity and other molecular mechanisms.EDG8 antibody
EDG8 antibody was raised using the N terminal of EDG8 corresponding to a region with amino acids MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIAnti-Giardia antibody
The Anti-Giardia antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets Giardia, a parasite that causes gastrointestinal infections. The antibody works by binding to specific antigens on the surface of Giardia, neutralizing its harmful effects.HP antibody
The HP antibody is a basic protein that plays a crucial role in various biological processes. It interacts with different molecules such as glucagon, osteopontin, antiphospholipid antibodies, and collagen. This versatile antibody has been extensively studied in the field of Life Sciences due to its wide range of applications.Troponin I antibody (Cardiac)
Troponin I antibody (cardiac) was raised in mouse using amino acid residues 26-35 of cTnI as the immunogen.
RASEF antibody
The RASEF antibody is a powerful tool in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and is specifically designed to target chemokine and interferon-related antigens. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and ELISA assays.ICOS antibody
ICOS antibody is a specific antibody that belongs to the group of agonist proteins known as monoclonal antibodies. It is commonly used in Life Sciences research and drug development. This antibody specifically targets the ICOS (Inducible T-cell CO-Stimulator) protein, which plays a crucial role in immune responses and T-cell activation. By binding to ICOS, this antibody activates the immune system and promotes the production of various growth factors and interleukins. Additionally, ICOS antibody can be used for detecting autoantibodies in human serum samples. Its high specificity and affinity make it an essential tool in biomedical research and diagnostic applications.
CD70 antibody (Preservative Free)
CD70 antibody (Preservative Free) was raised in mouse using human WM-1 (Waldenstrom’s macroglobulinemia) cell line as the immunogen.HIV1 gp41 antibody (HRP)
HIV1 gp41 antibody (HRP) was raised in goat using recombinant ectodomain of gp41 as the immunogen.CD8 Antibody
The CD8 Antibody is a chemokine used in Life Sciences research. It specifically targets CXCR4, Annexin, and Streptavidin. This Monoclonal Antibody has cytotoxic and neutralizing properties, making it valuable for studying various cellular processes. It has been shown to inhibit endothelial growth factor and hepatocyte growth factor signaling pathways, as well as TNF-α activation. Additionally, the CD8 Antibody can be used in experiments involving epidermal growth factor and electrode interactions. Its high specificity and potency make it an essential tool for researchers in the field of Life Sciences.Calcitonin antibody
Calcitonin antibody is a powerful tool used in life sciences research and diagnostics. It is a type of polyclonal antibody that specifically targets the growth hormone receptor. This antibody recognizes and binds to the receptor, blocking its activity and preventing the binding of growth hormone.
Arrestin 1 antibody
The Arrestin 1 antibody is a highly effective tool in the field of Life Sciences. This polyclonal antibody specifically targets and neutralizes Arrestin 1, a glycoprotein involved in hormone peptide signaling pathways. By binding to Arrestin 1, this antibody inhibits its function and prevents downstream signaling events, making it an essential tool for studying estrogen receptors and other related processes.Annexin A1 antibody
The Annexin A1 antibody is an essential tool in life sciences research. It is a polyclonal antibody that specifically targets Annexin A1, a protein involved in various cellular processes. This antibody recognizes the acidic and cysteine disulfide regions of Annexin A1, allowing for precise detection and analysis.
Hexokinase 2 antibody
Hexokinase 2 antibody was raised using the middle region of HK2 corresponding to a region with amino acids QRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFLRBNIP3 antibody
The BNIP3 antibody is a highly effective inhibitor used in the industrial sector. It belongs to the class of polyclonal antibodies and works by targeting specific antigens. This antibody has been shown to inhibit protein kinase activity, making it an essential tool in various research applications. Additionally, it has been found to have a significant impact on interferon and collagen production, making it a valuable asset in the field of life sciences. The BNIP3 antibody is also used for polypeptide expression and has been found to be effective in detecting autoantibodies. With its recombinant antigen properties, this antibody is widely used in microvessel endothelial cell studies.DRAP1 antibody
The DRAP1 antibody is an active agent that targets glycogen synthase kinase. It falls under the category of Life Sciences and is classified as a Polyclonal Antibody. This antibody specifically targets and activates chloride, making it an effective tool in various medical applications. With its high-flux capabilities, it can be used in assays to detect specific proteins or molecules. The DRAP1 antibody also shows promising results as an anti-mesothelin agent and interferon-stimulated gene inhibitor. Additionally, it has been found to have inhibitory effects on sirtuins, making it a versatile tool in the field of molecular research and drug development.Androgen receptor antibody
The Androgen Receptor Antibody is a highly effective tool in the field of Life Sciences. It is a polyclonal antibody that acts as an androgen receptor antagonist, making it ideal for studying the role of androgens in various biological processes. This antibody can be used to detect and quantify the presence of androgen receptors in human serum samples, allowing for a better understanding of their function.p53 antibody
The p53 antibody is a polyclonal antibody that is used for the detection of the p53 protein in various biological samples. It is commonly used in immunohistochemical studies to determine the expression and localization of p53 in tissues. This antibody specifically recognizes the p53 protein, which plays a crucial role in cell cycle regulation and tumor suppression.CCDC54 antibody
CCDC54 antibody was raised using the N terminal of CCDC54 corresponding to a region with amino acids MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLHIQGAP1 antibody
The IQGAP1 antibody is a highly specialized antibody that targets the protein IQGAP1. This protein plays a crucial role in various cellular processes, including cell signaling, cell adhesion, and cytoskeletal organization. By binding to IQGAP1, this antibody can effectively modulate its activity and function.
