Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
CDC42 antibody
The CDC42 antibody is a highly specific monoclonal antibody that is used in bioassays to detect and analyze the presence of CDC42, an important oncogene homolog. This antibody is designed to target the CDC42 protein, which plays a crucial role in various cellular processes, including cell growth, migration, and differentiation. The CDC42 antibody has been extensively tested and validated for its specificity and sensitivity in detecting CDC42 in human serum samples. It can be used in research studies investigating the involvement of CDC42 in cancer development and progression. Additionally, this antibody has shown potential as a diagnostic tool for detecting elevated levels of CDC42 in certain types of cancer, such as alpha-fetoprotein-positive hepatocellular carcinoma. Its high affinity and selectivity make it a valuable tool for researchers studying signal transduction pathways involving CDC42 or investigating therapeutic targets related to this protein.Benzodiazepine antibody
Benzodiazepine antibody was raised in mouse using benzodiazepine as the immunogen.
MAOA antibody
The MAOA antibody is a highly specific and potent inhibitor of the enzyme monoamine oxidase A (MAOA). This antibody binds to the active site of MAOA, preventing its enzymatic activity. MAOA plays a crucial role in the metabolism of histamine, serotonin, and other neurotransmitters, making it an important target for therapeutic interventions. The MAOA antibody has been extensively studied in various research areas, including neuroscience, oncology, and immunology.
EDG5 antibody
The EDG5 antibody is a polyclonal antibody that specifically targets the EDG5 receptor. This receptor plays a crucial role in various biological processes, including cell proliferation, migration, and survival. The EDG5 antibody has been shown to effectively block the binding of its ligands and inhibit downstream signaling pathways.MAPK15 antibody
MAPK15 antibody was raised using the middle region of MAPK15 corresponding to a region with amino acids GHDPAEHESPRAAKNVPRQNSAPLLQTALLGNGERPPGAKEAPPLTLSLV
Menin antibody
The Menin antibody is a monoclonal antibody that specifically targets the Menin protein. This antibody has been extensively studied and shown to have various functions and applications. It has been found to play a role in insulin regulation, as well as in the regulation of other important cellular processes such as cell growth and differentiation. The Menin antibody has also been used as a tool in research studies to study the function of the Menin protein and its interactions with other molecules. Furthermore, this antibody has potential therapeutic applications, including its use as a neutralizing agent for certain diseases or conditions related to Menin dysregulation. With its high specificity and potency, the Menin antibody is an invaluable tool in the field of Life Sciences for studying and understanding various biological processes.AKR1C3 antibody
The AKR1C3 antibody is a reactive antibody used in Life Sciences research. It can be used as both a polyclonal and monoclonal antibody. This antibody is commonly used to detect autoantibodies in human serum samples. It specifically targets AKR1C3, an enzyme that plays a role in hormone metabolism and has been implicated in various diseases, including cancer.SOCS2 antibody
The SOCS2 antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It specifically targets fatty acid, e-cadherin, and insulin antibodies. This antibody is widely used in research related to adipose tissue and adipocytes. It has been shown to have an impact on glycosylation and e-cadherin expression, which are important factors in various biological processes.GORASP1 antibody
GORASP1 antibody was raised using the N terminal of GORASP1 corresponding to a region with amino acids PYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEVZNF570 antibody
ZNF570 antibody was raised in rabbit using the middle region of ZNF570 as the immunogenPurity:Min. 95%CLCNKB antibody
CLCNKB antibody was raised using the C terminal of CLCNKB corresponding to a region with amino acids ILAAGCPTEPVTLKLSPETSLHEAHNLFELLNLHSLFVTSRGRAVGCVSWPurity:Min. 95%Cytokeratin 13 antibody
Cytokeratin 13 antibody was raised using the C terminal of KRT13 corresponding to a region with amino acids EAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPPAKAP1 antibody
AKAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPFSNGVLKGELSDLGAEDGWTMDAEADHSGVAAPPPGKRGTLITRCPGFNa, K ATPase antibody
Na, K ATPase antibody was raised in mouse using purified rat kidney Na, K ATPase as the immunogen.BAG2 antibody
BAG2 antibody was raised using the C terminal of BAG2 corresponding to a region with amino acids VDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSK
BDH1 antibody
BDH1 antibody was raised in Mouse using a purified recombinant fragment of human BDH1 expressed in E. coli as the immunogen.CYP2S1 antibody
The CYP2S1 antibody is a highly specialized insulin antibody that belongs to the group of polyclonal antibodies. It is specifically designed to target and neutralize tumor necrosis factor-alpha (TNF-α), a growth factor involved in various inflammatory processes. This monoclonal antibody has been extensively tested and proven effective in immunoassays, making it an invaluable tool for researchers studying TNF-α-related diseases. Additionally, the CYP2S1 antibody can be used in combination with other monoclonal antibodies to detect and quantify specific proteins, such as rubisco or insulin, in various biological samples. With its high specificity and sensitivity, this molecule drug holds great promise for advancing our understanding of complex molecular interactions and developing targeted therapies against TNF-α-mediated disorders.TRIB3 antibody
The TRIB3 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It specifically targets and binds to the growth factor TRIB3, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be an effective tool for research purposes.SLC16A1 antibody
SLC16A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINKCTD11 antibody
KCTD11 antibody was raised using the N terminal of KCTD11 corresponding to a region with amino acids RLGRLDLPRGYGETALLRAEADFYQIRPLLDALRELEASQGTPAPTAALL
ESRRA antibody
ESRRA antibody was raised using the N terminal of ESRRA corresponding to a region with amino acids KEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVNp63 antibody
The p63 antibody is a monoclonal antibody that specifically targets the p63 protein. It has been shown to have inhibitory properties against diacylglycerol and interferon, making it a potential therapeutic agent for various diseases. The p63 antibody is also known to inhibit the activity of histidine kinases, which are involved in cell signaling pathways. Additionally, this antibody has cytotoxic effects on cancer cells and can be used as a family kinase inhibitor. It has been shown to interact with β-catenin, a key protein involved in cell adhesion and signaling. The p63 antibody is widely used in Life Sciences research and can be utilized in studies related to epidermal growth factor and glycoprotein signaling pathways. Its unique properties make it a valuable tool for understanding cellular processes and developing new treatments in the field of molecular biology.
PDCD5 antibody
The PDCD5 antibody is a highly specialized monoclonal antibody used in Life Sciences. It is designed to target and bind to the protein known as Programmed Cell Death 5 (PDCD5). This antibody has been extensively studied for its potential therapeutic applications due to its ability to inhibit cell growth and induce apoptosis (programmed cell death).
LSM6 antibody
LSM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids YRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRR
