Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,542 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
SDCCAG8 antibody
SDCCAG8 antibody was raised using the middle region of SDCCAG8 corresponding to a region with amino acids IQCDQLRKELERQAERLEKELASQQEKRAIEKDMMKKEITKEREYMGSKM
LRP antibody (85 kDa)
LRP antibody (85 kDa) was raised in mouse using human LRP/a2MR as the immunogen.
PLXDC2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its effectiveness has been proven through extensive research using the patch-clamp technique on human erythrocytes.SNRPF antibody
SNRPF antibody was raised using the N terminal of SNRPF corresponding to a region with amino acids MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYComplement C3b α antibody
Complement C3a alpha antibody was raised in mouse using human complement component C3 as the immunogen.SLC17A5 antibody
SLC17A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLS
Purity:Min. 95%EPHB2 antibody
The EPHB2 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets the growth factor EPHB2, which plays a crucial role in various biological processes. This antibody has been extensively tested and proven to effectively bind to EPHB2 biomolecules, making it an ideal choice for research and diagnostic applications.
RHOD antibody
RHOD antibody was raised using the N terminal of RHOD corresponding to a region with amino acids TAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFPurity:Min. 95%SIRT5 antibody
The SIRT5 antibody is a highly effective Life Sciences product that is used in the field of medicine. It acts as an activated antinociceptive agent and works by inhibiting certain enzymes at the gas-liquid interface. This antibody specifically targets and binds to antigens involved in acetylation, such as collagen and sirtuins. By doing so, it helps regulate the process of acetylation and promotes overall cellular health.MMP14 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has shown its high efficacy using advanced techniques like patch-clamp on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets and binds to markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their growth in culture.CALB2 antibody
The CALB2 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to CALB2, also known as calbindin 2, which is a calcium-binding protein found in various tissues and cells. This antibody can be used for a range of applications, including immunohistochemistry, Western blotting, and flow cytometry.
TMPRSS6 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Through various metabolic transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it undergoes conversion into its active form. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth. With its patch-clamp technique on human erythrocytes, this drug demonstrates high frequency of human activity.
PTGER3 antibody
PTGER3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QMRKRRLREQLICSLQNSQIQRATAHCGQVQTYRVLNREEMEVLVSSINV
Purity:Min. 95%Arginase antibody
The Arginase antibody is a highly specialized monoclonal antibody that targets the protein arginase. Arginase is a glycoprotein that plays a crucial role in various biological processes, including the metabolism of arginine and the regulation of nitric oxide production. This antibody has been extensively tested and validated for use in Life Sciences research.
IL4 antibody
The IL4 antibody is a multidrug that targets specific proteins in the body. It has been shown to have a significant impact on human hepatocytes, inhibiting the production of alpha-fetoprotein and anti-glial fibrillary acidic protein. This antibody is part of a class of chimeric proteins known as polyclonal antibodies, which are widely used in Life Sciences research. The IL4 antibody also acts as an inhibitor, blocking the activity of certain enzymes and molecules involved in various biological processes. It is commonly conjugated with biotinylation and can be easily detected using streptavidin-based detection systems. With its high specificity and affinity, the IL4 antibody offers great potential for therapeutic applications and further scientific investigations.
HBsAg antibody (HRP)
HBsAg antibody (HRP) was raised in rabbit using subtypes ad & ay as the immunogen.Rb antibody
The Rb antibody is a highly specialized monoclonal antibody that targets mesenchymal stem cells. It acts as an anti-connexin agent, inhibiting the function of connexin proteins involved in cell communication. Additionally, this antibody has a high affinity for collagen and metal-binding proteins, making it an ideal tool for studying extracellular matrix interactions. The Rb antibody has also been used in research related to thrombotic thrombocytopenic purpura (TTP), a blood disorder characterized by clot formation in small blood vessels. Furthermore, polyclonal antibodies derived from this monoclonal antibody have been developed, allowing for broader applications in the life sciences field. It is important to note that proper handling and storage of this antibody are crucial to avoid contaminants and maintain its efficacy.
G16 antibody
The G16 antibody is a highly specialized antibody that targets glycoproteins and acts as an anti-connexin agent. This monoclonal antibody is widely used in Life Sciences research, particularly in studies involving estrogen receptors. It has been proven to effectively prevent denaturation of these receptors and inhibit their biochemical activity. Additionally, the G16 antibody can be used for hormone peptide recombination and has shown neutralizing properties against certain hormones. Its glycopeptide structure makes it highly specific and effective in various applications, including neuroprotective research.VEGF antibody (biotin)
VEGF antibody (biotin) was raised in rabbit using highly pure recombinant murine VEGF as the immunogen.
FGD1 antibody
FGD1 antibody was raised in rabbit using the C terminal of FGD1 as the immunogenPurity:Min. 95%RAB37 antibody
RAB37 antibody was raised in rabbit using the middle region of RAB37 as the immunogenPurity:Min. 95%
