Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,709 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(738 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75327 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CD117 antibody (Azide Free)
<p>CD117 antibody was raised in rat using murine CD117/c-Kit as the immunogen.</p>RXRB antibody
<p>RXRB antibody was raised using the N terminal of RXRB corresponding to a region with amino acids MHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGRDGMGDSG</p>NSE antibody
<p>The NSE antibody is a highly specialized monoclonal antibody that is used in various medical applications. It is commonly used in electrophoresis and high-dose chemotherapy procedures. This antibody specifically targets histone deacetylase inhibitors, which are involved in regulating gene expression and cell growth.</p>TFF1 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an active compound that belongs to the class of antituberculosis drugs known as rifamycins. It is highly effective in treating tuberculosis infections. This drug exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. The high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. 6-Fluoro-3-indoxyl-beta-D-galactopyranoside undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>GEM antibody
<p>GEM antibody was raised using the C terminal of GEM corresponding to a region with amino acids FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL</p>RAS antibody
<p>RAS antibody was raised in mouse using recombinant human NRAS (1-186aa) purified from E. coli as the immunogen.</p>HPRT antibody
<p>The HPRT antibody is a highly specialized monoclonal antibody that is used in various assays and experiments in the field of Life Sciences. It specifically targets the hypoxanthine-guanine phosphoribosyltransferase (HPRT) enzyme, which plays a crucial role in the metabolism of purine nucleotides.</p>PLEKHF1 antibody
<p>The PLEKHF1 antibody is a highly specialized monoclonal antibody that serves as a serum marker for various medical conditions. This antibody specifically targets and binds to the PLEKHF1 antigen, which plays a crucial role in the regulation of interleukin production and immune response. By inhibiting the activity of PLEKHF1, this antibody can be used as a potential medicament in the treatment of autoimmune diseases, inflammatory disorders, and certain types of cancers.</p>G3BP1 antibody
The G3BP1 antibody is a highly specialized monoclonal antibody that has been developed for use in Life Sciences research. It specifically targets and neutralizes the adeno-associated virus (AAV), which is commonly used as a vector in gene therapy applications. By inhibiting the activity of AAV, this antibody prevents viral replication and can be used to study the effects of AAV on cellular processes.GAP43 antibody
<p>The GAP43 antibody is a polyclonal antibody that is widely used in life sciences research. It is commonly used to study the role of interferon in cellular processes. The antibody is produced by immunizing animals with GAP43, a protein found in the nervous system. It has high specificity and affinity for its target, making it an ideal tool for detecting and quantifying GAP43 levels in various biological samples.</p>LTK antibody
LTK antibody is a highly specialized test compound used in Life Sciences research. It is an antibody that specifically targets and binds to the LTK protein, which plays a crucial role in various cellular processes. This antibody is commonly used in assays to study the function and activity of LTK in different cell types, including pluripotent stem cells and isolated retinal cells.Amphetamine antibody
The Amphetamine antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and interacts with amphetamine, a powerful stimulant drug. This antibody has been extensively studied for its potential in inhibiting the growth and proliferation of hepatocytes and endothelial cells. Additionally, it has shown promising results in combination with other antibodies, such as trastuzumab, for targeting specific growth factors involved in various diseases. The Amphetamine antibody has been found to bind to proteins like collagen, β-catenin, fibronectin, and VEGF-C, which are crucial for cell growth and development. Its anti-her2 antibody properties make it a valuable tool in research and therapeutic applications.Purity:>90%HSD17B1 antibody
HSD17B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAALRRC6 antibody
LRRC6 antibody was raised using the N terminal of LRRC6 corresponding to a region with amino acids LNLALNNIEKIENLEGCEELAKLDLTVNFIGELSSIKNLQHNIHLKELFLalpha 2 Macroglobulin antibody
<p>alpha 2 Macroglobulin antibody was raised in goat using human alpha 2 Macroglobulin purified from plasma as the immunogen.</p>NRF2 antibody
<p>The NRF2 antibody is a highly specific monoclonal antibody that plays a crucial role in iron homeostasis and transferrin regulation. It binds to NRF2, a transcription factor that regulates the expression of genes involved in cellular response to oxidative stress. This antibody has been extensively used in research to study the role of NRF2 in various diseases and conditions.</p>PTS antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively inhibiting bacterial growth and preventing transcription and replication. The effectiveness of this drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>IFN alpha antibody
<p>IFN alpha antibody was raised in Mouse using recombinant human IFN-alpha 2a as the immunogen.</p>GFAP antibody
<p>The GFAP antibody is a highly specialized antibody that targets glial fibrillary acidic protein (GFAP). This protein is primarily expressed in astrocytes, a type of glial cell in the central nervous system. The GFAP antibody has been extensively used in various research fields, including Life Sciences and Neuroscience.</p>Bax antibody
<p>The Bax antibody is a monoclonal antibody that specifically targets the protein Bax. Bax plays a crucial role in regulating cell death and apoptosis. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.</p>KYNU antibody
<p>KYNU antibody is a polyclonal antibody that specifically targets kynureninase (KYNU), an enzyme involved in the metabolism of tryptophan. KYNU plays a crucial role in the production of kynurenic acid, which has been implicated in various neurological and psychiatric disorders. This antibody can be used in research assays to detect and quantify KYNU levels in biological samples, allowing for a better understanding of its function and potential therapeutic applications. With its high specificity and sensitivity, the KYNU antibody is a valuable tool for scientists and researchers working in the field of life sciences. Whether studying autoimmune diseases, developing new medicines, or exploring the role of kynurenine pathway intermediates, this antibody provides reliable results and contributes to advancements in biomedical research.</p>CRABP1 antibody
CRABP1 antibody was raised in mouse using recombinant human CRABP1 (1-137aa) purified from E. coli as the immunogen.ZCCHC13 antibody
ZCCHC13 antibody was raised using the middle region of ZCCHC13 corresponding to a region with amino acids GKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMS
