Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,764 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75326 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
MMP15 antibody
The MMP15 antibody is a powerful tool used in Life Sciences research. It specifically targets and neutralizes the activity of matrix metalloproteinase 15 (MMP15), an enzyme involved in various biological processes such as tissue remodeling, wound healing, and cancer progression.GLCCI1 antibody
GLCCI1 antibody was raised using the middle region of GLCCI1 corresponding to a region with amino acids PYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSADPRKRA antibody
PRKRA antibody was raised in mouse using recombinant Human Protein Kinase, Interferon-Inducible Double Stranded Rna Dependent ActivatorSTMN1 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds with bactericidal activity. Through extensive research, it has been determined that this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication.</p>CDC25C antibody
<p>CDC25C antibody was raised in rabbit using the N terminal of CDC25C as the immunogen</p>SETD7 antibody
The SETD7 antibody is a monoclonal antibody that specifically targets SETD7, an enzyme involved in various cellular processes. This antibody has been shown to react with levothyroxine and interleukin-6, indicating its potential role in modulating thyroid hormone levels and immune responses. Additionally, the SETD7 antibody has demonstrated reactivity towards basic proteins such as collagen, suggesting its involvement in extracellular matrix remodeling. Furthermore, this monoclonal antibody may have implications in cholinergic signaling due to its reactivity with acetylcholine and acetyltransferase. Overall, the SETD7 antibody shows promise as a versatile tool for studying protein function and exploring potential therapeutic applications.TP53 antibody
The TP53 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the TP53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. The TP53 antibody binds to the collagen and actin filaments within cells, allowing for the detection and study of TP53 expression levels.GPR18 antibody
The GPR18 antibody is a monoclonal antibody that specifically targets the G protein-coupled receptor 18 (GPR18). This receptor is located on the apical membrane of various cell types, including functional endothelial cells. The GPR18 antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.CCL5 antibody
The CCL5 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed for neutralizing the activity of CCL5, a chemokine involved in various cellular processes such as inflammation and immune response. This antibody binds to the CCL5 antigen, blocking its interaction with receptors and preventing downstream signaling events.AFP antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting strong bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. Its effectiveness has been demonstrated in various studies using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.C1ORF103 antibody
C1ORF103 antibody was raised using the middle region of C1Orf103 corresponding to a region with amino acids SHSKTRQEKRTEMEYYTHEKQEKGTLNSNAAYEQSHFFNKNYTEDIFPVTWDR34 antibody
<p>WDR34 antibody was raised using the C terminal of WDR34 corresponding to a region with amino acids SLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDES</p>KCTD21 antibody
<p>KCTD21 antibody was raised using the middle region of KCTD21 corresponding to a region with amino acids VFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANV</p>MMP19 antibody
<p>The MMP19 antibody is a monoclonal antibody that specifically targets the matrix metalloproteinase 19 (MMP19). This glycoprotein plays a crucial role in various biological processes, including tissue remodeling and wound healing. The MMP19 antibody is widely used in Life Sciences research to study the function and regulation of MMP19.</p>CD22 antibody (Azide Free)
<p>CD22 antibody (Azide free) was raised in rat using CD22 as the immunogen.</p>ING3 antibody
<p>ING3 antibody was raised using the N terminal of ING3 corresponding to a region with amino acids MDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQ</p>Ferritin heavy chain antibody
<p>The Ferritin heavy chain antibody is a highly effective monoclonal antibody used in Life Sciences. It is designed to specifically target and bind to the Ferritin heavy chain protein, which plays a crucial role in iron storage and transport within cells. This antibody is colloidal in nature, making it easy to use in various experimental techniques.</p>CD23 Antibody
The CD23 Antibody is a monoclonal antibody that targets the IL-2 receptor, specifically the low-affinity receptor. This antibody has been extensively studied in in-vitro culture and Life Sciences research. It has been shown to have various biological activities, including growth factor activity and antioxidant activity. The CD23 Antibody binds to the CD23 receptor molecule, which is expressed on various cell types, such as granulosa cells. This antibody can be used in experiments involving transcription-polymerase chain reaction (PCR) or immunohistochemistry. It is an essential tool for researchers working with Monoclonal Antibodies and studying various biological processes.TREM2 antibody
TREM2 antibody was raised using the middle region of TREM2 corresponding to a region with amino acids FPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASAUGT2B7 antibody
<p>The UGT2B7 antibody is a powerful tool in Life Sciences research. This antibody has the ability to neutralize fatty acids and EGF-like molecules, making it an essential component in various immunoassays and molecular docking experiments. It exhibits high affinity for human serum albumin and cationic molecules, allowing for precise targeting and detection of specific proteins or chemokines. The UGT2B7 antibody belongs to the class of polyclonal antibodies, ensuring a wide range of binding specificity. With its exceptional performance and versatility, this antibody is a valuable asset for researchers in the field of Life Sciences.</p>ECHDC3 antibody
ECHDC3 antibody was raised using the N terminal of ECHDC3 corresponding to a region with amino acids SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDY
